BLASTX nr result
ID: Angelica22_contig00039152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039152 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL25647.1|AF197330_1 calcineurin-like protein [Eucalyptus gr... 44 1e-07 ref|XP_002276287.1| PREDICTED: calcineurin subunit B isoform 1 [... 41 1e-07 ref|XP_002517685.1| calcineurin B subunit, putative [Ricinus com... 45 2e-07 ref|NP_001235273.1| uncharacterized protein LOC100305685 [Glycin... 45 4e-07 ref|XP_002271539.1| PREDICTED: calcineurin subunit B isoform 1 [... 44 6e-07 >gb|AAL25647.1|AF197330_1 calcineurin-like protein [Eucalyptus grandis] gi|16550937|gb|AAL25650.1|AF197334_1 calcineurin-like protein [Eucalyptus camaldulensis] Length = 175 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 19/30 (63%), Positives = 27/30 (90%) Frame = +1 Query: 1 TGSFMSDGKREEVLNEVLKEAGYTRKSFIV 90 +G FMSD +RE+VL +VLKEAGYTR+S+++ Sbjct: 124 SGPFMSDEQREQVLVQVLKEAGYTRESYLL 153 Score = 37.4 bits (85), Expect(2) = 1e-07 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = +2 Query: 83 LLLDDFIKILGNPSLKMEVEILVN 154 LLLDDF+K+ GN LKMEVE+ V+ Sbjct: 152 LLLDDFVKVFGNSDLKMEVEVPVD 175 >ref|XP_002276287.1| PREDICTED: calcineurin subunit B isoform 1 [Vitis vinifera] gi|147822751|emb|CAN72695.1| hypothetical protein VITISV_007127 [Vitis vinifera] gi|297743673|emb|CBI36556.3| unnamed protein product [Vitis vinifera] Length = 175 Score = 41.2 bits (95), Expect(2) = 1e-07 Identities = 18/28 (64%), Positives = 24/28 (85%) Frame = +2 Query: 71 QGNLLLLDDFIKILGNPSLKMEVEILVN 154 + +LL+L DF+KILGNP LKMEVE+ V+ Sbjct: 148 KNSLLVLSDFVKILGNPDLKMEVEVPVD 175 Score = 39.7 bits (91), Expect(2) = 1e-07 Identities = 17/30 (56%), Positives = 24/30 (80%) Frame = +1 Query: 1 TGSFMSDGKREEVLNEVLKEAGYTRKSFIV 90 TG F+S+ +REEVL +VL+EAGY + S +V Sbjct: 124 TGQFISEKQREEVLTQVLEEAGYNKNSLLV 153 >ref|XP_002517685.1| calcineurin B subunit, putative [Ricinus communis] gi|223543317|gb|EEF44849.1| calcineurin B subunit, putative [Ricinus communis] Length = 175 Score = 45.4 bits (106), Expect(2) = 2e-07 Identities = 20/30 (66%), Positives = 28/30 (93%) Frame = +1 Query: 1 TGSFMSDGKREEVLNEVLKEAGYTRKSFIV 90 +GSFMSD +RE+VL +VLKEAGYTR+S+++ Sbjct: 124 SGSFMSDEQREQVLCQVLKEAGYTRESYLM 153 Score = 34.7 bits (78), Expect(2) = 2e-07 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = +2 Query: 83 LLLDDFIKILGNPSLKMEVEILVN 154 L+LDDFIK+ GN L MEVE+ V+ Sbjct: 152 LMLDDFIKVFGNSGLTMEVEVPVD 175 >ref|NP_001235273.1| uncharacterized protein LOC100305685 [Glycine max] gi|255626307|gb|ACU13498.1| unknown [Glycine max] Length = 175 Score = 45.1 bits (105), Expect(2) = 4e-07 Identities = 19/29 (65%), Positives = 27/29 (93%) Frame = +1 Query: 1 TGSFMSDGKREEVLNEVLKEAGYTRKSFI 87 +GSFMSD +REEVL++VL+EAGYT+ S++ Sbjct: 124 SGSFMSDDQREEVLSQVLREAGYTKDSYL 152 Score = 33.9 bits (76), Expect(2) = 4e-07 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = +2 Query: 83 LLLDDFIKILGNPSLKMEVEILVN 154 L LDDFIK+LG LKM+VE+ V+ Sbjct: 152 LTLDDFIKVLGQSDLKMDVEVPVD 175 >ref|XP_002271539.1| PREDICTED: calcineurin subunit B isoform 1 [Vitis vinifera] gi|297743542|emb|CBI36409.3| unnamed protein product [Vitis vinifera] Length = 175 Score = 43.9 bits (102), Expect(2) = 6e-07 Identities = 20/27 (74%), Positives = 25/27 (92%) Frame = +1 Query: 1 TGSFMSDGKREEVLNEVLKEAGYTRKS 81 TGSFMSD +RE+VL+ VL+EAGYTR+S Sbjct: 124 TGSFMSDKQREQVLSHVLQEAGYTRES 150 Score = 34.3 bits (77), Expect(2) = 6e-07 Identities = 15/23 (65%), Positives = 21/23 (91%) Frame = +2 Query: 86 LLDDFIKILGNPSLKMEVEILVN 154 LL+DFIK+LG+ S+KM+VEI V+ Sbjct: 153 LLEDFIKVLGSSSIKMDVEIPVD 175