BLASTX nr result
ID: Angelica22_contig00039122
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039122 (213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625129.1| Kinesin-like polypeptide [Medicago truncatul... 63 3e-08 >ref|XP_003625129.1| Kinesin-like polypeptide [Medicago truncatula] gi|355500144|gb|AES81347.1| Kinesin-like polypeptide [Medicago truncatula] Length = 1012 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +3 Query: 84 METCVRKTLHELNLAGRKQEEAALRRYEATEWLESLVGPLGIS 212 ME C R H+ ++ RK EEAALRRYEAT+WLE+ VGPLGIS Sbjct: 1 MENCSRNGFHDFKMSSRKAEEAALRRYEATQWLENQVGPLGIS 43