BLASTX nr result
ID: Angelica22_contig00039040
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00039040 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP93964.1| metallothionein type 2 [Ilex paraguariensis] 93 2e-17 gb|ACU14245.1| unknown [Glycine max] gi|228682|prf||1808316A met... 92 6e-17 gb|ADM86706.1| metallothionein-like protein [Cicer microphyllum] 91 7e-17 sp|Q39459.2|MT2_CICAR RecName: Full=Metallothionein-like protein... 91 7e-17 ref|NP_001235506.1| metallothionein type 2 [Glycine max] gi|4707... 91 1e-16 >gb|AFP93964.1| metallothionein type 2 [Ilex paraguariensis] Length = 78 Score = 93.2 bits (230), Expect = 2e-17 Identities = 42/56 (75%), Positives = 50/56 (89%), Gaps = 2/56 (3%) Frame = -3 Query: 292 KMFPD--FNESTTSETLIVGVAPAKSFYEGSEMGVGAENDGCKCGDKCTCNPCTCK 131 KM+PD ++ESTT+ETLIVGVAP K+++EGSEMGVGAEN GCKCGD CTC+PC CK Sbjct: 24 KMYPDLSYSESTTTETLIVGVAPQKTYFEGSEMGVGAEN-GCKCGDNCTCDPCNCK 78 >gb|ACU14245.1| unknown [Glycine max] gi|228682|prf||1808316A metallothionein-like protein Length = 79 Score = 91.7 bits (226), Expect = 6e-17 Identities = 39/56 (69%), Positives = 48/56 (85%), Gaps = 2/56 (3%) Frame = -3 Query: 292 KMFPD--FNESTTSETLIVGVAPAKSFYEGSEMGVGAENDGCKCGDKCTCNPCTCK 131 KM+PD + ESTT+ETL++GVAP K+ +EG+EMGV AENDGCKCG C+CNPCTCK Sbjct: 24 KMYPDLSYTESTTTETLVMGVAPVKAQFEGAEMGVPAENDGCKCGPNCSCNPCTCK 79 >gb|ADM86706.1| metallothionein-like protein [Cicer microphyllum] Length = 79 Score = 91.3 bits (225), Expect = 7e-17 Identities = 39/56 (69%), Positives = 46/56 (82%), Gaps = 2/56 (3%) Frame = -3 Query: 292 KMFPD--FNESTTSETLIVGVAPAKSFYEGSEMGVGAENDGCKCGDKCTCNPCTCK 131 KM+PD + E TTSETL++GVA K+ +EG+EMG GAENDGCKCG CTCNPCTCK Sbjct: 24 KMYPDMSYTEQTTSETLVMGVASVKTQFEGAEMGFGAENDGCKCGSNCTCNPCTCK 79 >sp|Q39459.2|MT2_CICAR RecName: Full=Metallothionein-like protein 2; Short=MT-2 gi|2815246|emb|CAA65009.1| class I type 2 metallothionein [Cicer arietinum] Length = 79 Score = 91.3 bits (225), Expect = 7e-17 Identities = 39/56 (69%), Positives = 46/56 (82%), Gaps = 2/56 (3%) Frame = -3 Query: 292 KMFPD--FNESTTSETLIVGVAPAKSFYEGSEMGVGAENDGCKCGDKCTCNPCTCK 131 KM+PD + E TTSETL++GVA K+ +EG+EMG GAENDGCKCG CTCNPCTCK Sbjct: 24 KMYPDMSYTEQTTSETLVMGVASGKTQFEGAEMGFGAENDGCKCGSNCTCNPCTCK 79 >ref|NP_001235506.1| metallothionein type 2 [Glycine max] gi|47076854|dbj|BAD18377.1| type 2 metallothionein [Glycine max] Length = 79 Score = 90.5 bits (223), Expect = 1e-16 Identities = 39/56 (69%), Positives = 47/56 (83%), Gaps = 2/56 (3%) Frame = -3 Query: 292 KMFPD--FNESTTSETLIVGVAPAKSFYEGSEMGVGAENDGCKCGDKCTCNPCTCK 131 KM+PD + ESTT+ETL++GVAP K+ +E +EMGV AENDGCKCG CTCNPCTCK Sbjct: 24 KMYPDLSYTESTTTETLVMGVAPVKAQFESAEMGVPAENDGCKCGANCTCNPCTCK 79