BLASTX nr result
ID: Angelica22_contig00038966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00038966 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266801.2| PREDICTED: transcription factor RAX3 [Vitis ... 89 3e-16 emb|CBI41089.3| unnamed protein product [Vitis vinifera] 89 3e-16 gb|AAS10047.1| MYB transcription factor [Arabidopsis thaliana] 89 3e-16 ref|NP_181226.1| transcription factor RAX2 [Arabidopsis thaliana... 89 3e-16 gb|AEZ35207.1| ntrax [Nicotiana tabacum] 89 5e-16 >ref|XP_002266801.2| PREDICTED: transcription factor RAX3 [Vitis vinifera] Length = 316 Score = 89.4 bits (220), Expect = 3e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 87 MGRAPCCDKANVKRGPWSPEEDAKLKEYIEKNGSGGNWIAL 209 MGRAPCCDKANVK+GPWSPEEDAKLK YIEKNG+GGNWIAL Sbjct: 1 MGRAPCCDKANVKKGPWSPEEDAKLKTYIEKNGTGGNWIAL 41 >emb|CBI41089.3| unnamed protein product [Vitis vinifera] Length = 339 Score = 89.4 bits (220), Expect = 3e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 87 MGRAPCCDKANVKRGPWSPEEDAKLKEYIEKNGSGGNWIAL 209 MGRAPCCDKANVK+GPWSPEEDAKLK YIEKNG+GGNWIAL Sbjct: 1 MGRAPCCDKANVKKGPWSPEEDAKLKTYIEKNGTGGNWIAL 41 >gb|AAS10047.1| MYB transcription factor [Arabidopsis thaliana] Length = 298 Score = 89.4 bits (220), Expect = 3e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 87 MGRAPCCDKANVKRGPWSPEEDAKLKEYIEKNGSGGNWIAL 209 MGRAPCCDKANVKRGPWSPEEDAKLK+YIEK G+GGNWIAL Sbjct: 1 MGRAPCCDKANVKRGPWSPEEDAKLKDYIEKQGTGGNWIAL 41 >ref|NP_181226.1| transcription factor RAX2 [Arabidopsis thaliana] gi|75337316|sp|Q9SJL7.1|RAX2_ARATH RecName: Full=Transcription factor RAX2; AltName: Full=Myb-related protein 38; Short=AtMYB38; AltName: Full=Protein REGULATOR OF AXILLARY MERISTEMS 2 gi|4883605|gb|AAD31574.1| light-regulated myb protein, putative [Arabidopsis thaliana] gi|330254221|gb|AEC09315.1| transcription factor RAX2 [Arabidopsis thaliana] Length = 298 Score = 89.4 bits (220), Expect = 3e-16 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +3 Query: 87 MGRAPCCDKANVKRGPWSPEEDAKLKEYIEKNGSGGNWIAL 209 MGRAPCCDKANVKRGPWSPEEDAKLK+YIEK G+GGNWIAL Sbjct: 1 MGRAPCCDKANVKRGPWSPEEDAKLKDYIEKQGTGGNWIAL 41 >gb|AEZ35207.1| ntrax [Nicotiana tabacum] Length = 317 Score = 88.6 bits (218), Expect = 5e-16 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +3 Query: 87 MGRAPCCDKANVKRGPWSPEEDAKLKEYIEKNGSGGNWIAL 209 MGRAPCCDKANVK+GPWSPEEDAKLK+YIEK+G+GGNWIAL Sbjct: 1 MGRAPCCDKANVKKGPWSPEEDAKLKDYIEKSGTGGNWIAL 41