BLASTX nr result
ID: Angelica22_contig00038847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00038847 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621555.1| F-box protein [Medicago truncatula] gi|35549... 55 6e-06 gb|ABD33336.2| Cyclin-like F-box; F-box protein interaction doma... 55 6e-06 ref|XP_003615467.1| F-box protein [Medicago truncatula] gi|35551... 55 8e-06 >ref|XP_003621555.1| F-box protein [Medicago truncatula] gi|355496570|gb|AES77773.1| F-box protein [Medicago truncatula] Length = 399 Score = 55.1 bits (131), Expect = 6e-06 Identities = 37/102 (36%), Positives = 52/102 (50%), Gaps = 24/102 (23%) Frame = +3 Query: 3 WNPATRQAKVIPT--FRDVHHEAL-----GFGYDVIDDDYKIVRVVM------------- 122 WNP T++ KVIPT F V H + GFGYD + +DYKI+R VM Sbjct: 140 WNPTTQEFKVIPTSPFEFVPHMDVDILRHGFGYDCVTNDYKIIRQVMCYHKIDIDVYLLE 199 Query: 123 ---PPSFSEVYSVKRNVWRKVPDPIDTPLG-GDFDVCVNGFL 236 F E+YS++ N WRK+ D P+ + VC++G + Sbjct: 200 DIDNDHFWEIYSLRSNSWRKL--EYDIPINHKESGVCLDGMV 239 >gb|ABD33336.2| Cyclin-like F-box; F-box protein interaction domain; Galactose oxidase, central [Medicago truncatula] Length = 401 Score = 55.1 bits (131), Expect = 6e-06 Identities = 37/102 (36%), Positives = 52/102 (50%), Gaps = 24/102 (23%) Frame = +3 Query: 3 WNPATRQAKVIPT--FRDVHHEAL-----GFGYDVIDDDYKIVRVVM------------- 122 WNP T++ KVIPT F V H + GFGYD + +DYKI+R VM Sbjct: 142 WNPTTQEFKVIPTSPFEFVPHMDVDILRHGFGYDCVTNDYKIIRQVMCYHKIDIDVYLLE 201 Query: 123 ---PPSFSEVYSVKRNVWRKVPDPIDTPLG-GDFDVCVNGFL 236 F E+YS++ N WRK+ D P+ + VC++G + Sbjct: 202 DIDNDHFWEIYSLRSNSWRKL--EYDIPINHKESGVCLDGMV 241 >ref|XP_003615467.1| F-box protein [Medicago truncatula] gi|355516802|gb|AES98425.1| F-box protein [Medicago truncatula] Length = 278 Score = 54.7 bits (130), Expect = 8e-06 Identities = 34/91 (37%), Positives = 50/91 (54%), Gaps = 8/91 (8%) Frame = +3 Query: 3 WNPATRQAKVIPTFRDVHHEAL---GFGYDVIDDDYKIVRVV----MPPSFSEVYSVKRN 161 WNPA + KVIP + + GF YD + DDYK+++ V E+YS+K + Sbjct: 48 WNPAPEKVKVIPPSQLEFSYGIMDHGFDYDHVRDDYKLIQYVDVVECHDPLWEIYSLKSD 107 Query: 162 VWRKVPDPIDTPLGGDFD-VCVNGFLCGIGD 251 WRK+ ID P+ +FD VC+NG +G+ Sbjct: 108 SWRKM--DIDMPIRINFDNVCLNGICHWLGE 136