BLASTX nr result
ID: Angelica22_contig00038471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00038471 (466 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL32509.1| hypothetical protein 2-like [Daucus carota] 63 3e-08 >gb|AAL32509.1| hypothetical protein 2-like [Daucus carota] Length = 105 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = +1 Query: 10 FIFIRNDEQEQAFNGIEDMLADLELINGHLESIDTLGSMVNSCGGI 147 FIFI+++EQE+AF GIED+L DLEL+NG+++SIDTLG M + G + Sbjct: 38 FIFIKDNEQEKAFFGIEDLLVDLELVNGYIKSIDTLGCMYSRIGPV 83