BLASTX nr result
ID: Angelica22_contig00038385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00038385 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containi... 92 6e-17 ref|XP_002518527.1| pentatricopeptide repeat-containing protein,... 87 2e-15 ref|NP_193849.2| pentatricopeptide repeat-containing protein [Ar... 84 2e-14 sp|O49558.2|PP331_ARATH RecName: Full=Pentatricopeptide repeat-c... 84 2e-14 emb|CAA17536.1| putative protein [Arabidopsis thaliana] gi|72689... 84 2e-14 >ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21170-like [Vitis vinifera] Length = 569 Score = 91.7 bits (226), Expect = 6e-17 Identities = 41/66 (62%), Positives = 52/66 (78%) Frame = +3 Query: 3 RVEEALKIFDYMRTHNLLNGESFSAMISGLCHENDLKKAMKLHDEMLNLGLKPDLKNYKR 182 R+E+A+ +FD MR+ NLL+ SF+ M+SGLC E +L+KAMK HDEML +GLKPD YKR Sbjct: 504 RIEDAVSVFDCMRSQNLLSSTSFTIMVSGLCRERELRKAMKFHDEMLKMGLKPDRATYKR 563 Query: 183 LISSFK 200 LIS FK Sbjct: 564 LISGFK 569 >ref|XP_002518527.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542372|gb|EEF43914.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 599 Score = 86.7 bits (213), Expect = 2e-15 Identities = 40/65 (61%), Positives = 49/65 (75%) Frame = +3 Query: 3 RVEEALKIFDYMRTHNLLNGESFSAMISGLCHENDLKKAMKLHDEMLNLGLKPDLKNYKR 182 RVEE++K+FDYM+ L N SF+ +I GLC +L+KAMKLHDEMLN+GLKPD YKR Sbjct: 527 RVEESIKVFDYMKGLKLANSASFTVIIRGLCRAKELRKAMKLHDEMLNMGLKPDKPTYKR 586 Query: 183 LISSF 197 LI F Sbjct: 587 LILEF 591 >ref|NP_193849.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332659015|gb|AEE84415.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 551 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/65 (60%), Positives = 49/65 (75%) Frame = +3 Query: 6 VEEALKIFDYMRTHNLLNGESFSAMISGLCHENDLKKAMKLHDEMLNLGLKPDLKNYKRL 185 VEEA+ +F+YM+ N +N +SF+ MI GLC ++KKAM+ HDEML LGLKPDL YKRL Sbjct: 487 VEEAVVVFEYMKEINSVNSKSFTIMIQGLCRVKEMKKAMRSHDEMLRLGLKPDLVTYKRL 546 Query: 186 ISSFK 200 I FK Sbjct: 547 ILGFK 551 >sp|O49558.2|PP331_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g21170 Length = 585 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/65 (60%), Positives = 49/65 (75%) Frame = +3 Query: 6 VEEALKIFDYMRTHNLLNGESFSAMISGLCHENDLKKAMKLHDEMLNLGLKPDLKNYKRL 185 VEEA+ +F+YM+ N +N +SF+ MI GLC ++KKAM+ HDEML LGLKPDL YKRL Sbjct: 521 VEEAVVVFEYMKEINSVNSKSFTIMIQGLCRVKEMKKAMRSHDEMLRLGLKPDLVTYKRL 580 Query: 186 ISSFK 200 I FK Sbjct: 581 ILGFK 585 >emb|CAA17536.1| putative protein [Arabidopsis thaliana] gi|7268914|emb|CAB79117.1| putative protein [Arabidopsis thaliana] Length = 534 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/65 (60%), Positives = 49/65 (75%) Frame = +3 Query: 6 VEEALKIFDYMRTHNLLNGESFSAMISGLCHENDLKKAMKLHDEMLNLGLKPDLKNYKRL 185 VEEA+ +F+YM+ N +N +SF+ MI GLC ++KKAM+ HDEML LGLKPDL YKRL Sbjct: 470 VEEAVVVFEYMKEINSVNSKSFTIMIQGLCRVKEMKKAMRSHDEMLRLGLKPDLVTYKRL 529 Query: 186 ISSFK 200 I FK Sbjct: 530 ILGFK 534