BLASTX nr result
ID: Angelica22_contig00038318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00038318 (338 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534781.1| PREDICTED: reticuline oxidase-like protein-l... 62 6e-08 ref|XP_002890893.1| FAD-binding domain-containing protein [Arabi... 62 6e-08 ref|NP_171700.1| FAD-binding and BBE domain-containing protein [... 61 1e-07 ref|XP_002889343.1| ATSEC1A [Arabidopsis lyrata subsp. lyrata] g... 61 1e-07 ref|XP_002523158.1| Reticuline oxidase precursor, putative [Rici... 61 1e-07 >ref|XP_003534781.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max] Length = 533 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 338 GEKYFGANFERLVKVKSAVDPENFFRNEQSIPVKVMQS 225 G KYF NF+RLVKVK+AVDPENFFRNEQSIPV +++ Sbjct: 496 GAKYFNDNFQRLVKVKTAVDPENFFRNEQSIPVSPIKA 533 >ref|XP_002890893.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336735|gb|EFH67152.1| FAD-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 537 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 338 GEKYFGANFERLVKVKSAVDPENFFRNEQSIP 243 G KYFG NF+RLV+VK+AVDPENFFRNEQSIP Sbjct: 499 GRKYFGENFDRLVRVKTAVDPENFFRNEQSIP 530 >ref|NP_171700.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana] gi|8570449|gb|AAF76476.1|AC020622_10 Contains similarity to berberine bridge enzyme from Berberis stolonifera gb|AF049347 and contains a FAD binding PF|01565 domain [Arabidopsis thaliana] gi|332189241|gb|AEE27362.1| FAD-binding and BBE domain-containing protein [Arabidopsis thaliana] Length = 541 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 338 GEKYFGANFERLVKVKSAVDPENFFRNEQSIP 243 G KYFG NF+RLVKVK+AVDPENFFR+EQSIP Sbjct: 501 GRKYFGENFDRLVKVKTAVDPENFFRDEQSIP 532 >ref|XP_002889343.1| ATSEC1A [Arabidopsis lyrata subsp. lyrata] gi|297335185|gb|EFH65602.1| ATSEC1A [Arabidopsis lyrata subsp. lyrata] Length = 541 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 338 GEKYFGANFERLVKVKSAVDPENFFRNEQSIP 243 G KYFG NF+RLVKVK+AVDPENFFR+EQSIP Sbjct: 501 GRKYFGENFDRLVKVKTAVDPENFFRDEQSIP 532 >ref|XP_002523158.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537565|gb|EEF39189.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 539 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 338 GEKYFGANFERLVKVKSAVDPENFFRNEQSIP 243 G KYF NF+RLVKVK+AVDPENFFRNEQSIP Sbjct: 502 GHKYFNGNFDRLVKVKTAVDPENFFRNEQSIP 533