BLASTX nr result
ID: Angelica22_contig00038260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00038260 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containi... 147 7e-34 emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] 147 7e-34 ref|XP_003518493.1| PREDICTED: pentatricopeptide repeat-containi... 141 6e-32 ref|XP_002510967.1| pentatricopeptide repeat-containing protein,... 141 6e-32 ref|XP_002307901.1| predicted protein [Populus trichocarpa] gi|2... 141 6e-32 >ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Vitis vinifera] Length = 740 Score = 147 bits (372), Expect = 7e-34 Identities = 66/87 (75%), Positives = 80/87 (91%) Frame = -1 Query: 262 EEGVVFRESLFICIMRYYAKAGLPGQSTRLLFDMRDVFSCEPSFRSYNVVLDILVAGDCP 83 +EG+VFRESLFI IM++Y +AGLPGQ+TRLL DMR V+SCEP+FRSYNVVLD+L+AG+CP Sbjct: 157 QEGIVFRESLFILIMKHYGRAGLPGQATRLLLDMRGVYSCEPTFRSYNVVLDVLLAGNCP 216 Query: 82 AVAPNIFYEMLRKGVSPTVFTFGVVMK 2 V PN+FYEML KG+SPTV+TFGVVMK Sbjct: 217 KVVPNVFYEMLSKGISPTVYTFGVVMK 243 >emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] Length = 722 Score = 147 bits (372), Expect = 7e-34 Identities = 66/87 (75%), Positives = 80/87 (91%) Frame = -1 Query: 262 EEGVVFRESLFICIMRYYAKAGLPGQSTRLLFDMRDVFSCEPSFRSYNVVLDILVAGDCP 83 +EG+VFRESLFI IM++Y +AGLPGQ+TRLL DMR V+SCEP+FRSYNVVLD+L+AG+CP Sbjct: 139 QEGIVFRESLFILIMKHYGRAGLPGQATRLLLDMRGVYSCEPTFRSYNVVLDVLLAGNCP 198 Query: 82 AVAPNIFYEMLRKGVSPTVFTFGVVMK 2 V PN+FYEML KG+SPTV+TFGVVMK Sbjct: 199 KVVPNVFYEMLSKGISPTVYTFGVVMK 225 >ref|XP_003518493.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Glycine max] Length = 725 Score = 141 bits (355), Expect = 6e-32 Identities = 64/87 (73%), Positives = 79/87 (90%) Frame = -1 Query: 262 EEGVVFRESLFICIMRYYAKAGLPGQSTRLLFDMRDVFSCEPSFRSYNVVLDILVAGDCP 83 +EG++F+ESLFI IM++Y KAGLPGQ+TRLL DM V+SC+P+F+SYNVVLDILV GDCP Sbjct: 127 DEGLLFKESLFILIMKHYGKAGLPGQATRLLLDMWGVYSCDPTFKSYNVVLDILVDGDCP 186 Query: 82 AVAPNIFYEMLRKGVSPTVFTFGVVMK 2 VAPN+FY+ML +GVSPTV+TFGVVMK Sbjct: 187 RVAPNVFYDMLSRGVSPTVYTFGVVMK 213 >ref|XP_002510967.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550082|gb|EEF51569.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 774 Score = 141 bits (355), Expect = 6e-32 Identities = 63/87 (72%), Positives = 77/87 (88%) Frame = -1 Query: 262 EEGVVFRESLFICIMRYYAKAGLPGQSTRLLFDMRDVFSCEPSFRSYNVVLDILVAGDCP 83 EEG+ FRESLFICIM+YY +A LPGQ+TR+L DM+ V+ CEP+F+SYNVVLDILV+ +CP Sbjct: 130 EEGIAFRESLFICIMKYYGRANLPGQATRMLLDMKGVYCCEPTFKSYNVVLDILVSANCP 189 Query: 82 AVAPNIFYEMLRKGVSPTVFTFGVVMK 2 +VA N+FYEML KGV PTV+TFGVVMK Sbjct: 190 SVAANVFYEMLSKGVIPTVYTFGVVMK 216 >ref|XP_002307901.1| predicted protein [Populus trichocarpa] gi|222853877|gb|EEE91424.1| predicted protein [Populus trichocarpa] Length = 724 Score = 141 bits (355), Expect = 6e-32 Identities = 64/87 (73%), Positives = 77/87 (88%) Frame = -1 Query: 262 EEGVVFRESLFICIMRYYAKAGLPGQSTRLLFDMRDVFSCEPSFRSYNVVLDILVAGDCP 83 EEG+VFRESLFI IM+YY +AGLPGQ+TRLL DM+ V+ CEPSFRSYNVVLD+LV G+CP Sbjct: 132 EEGIVFRESLFILIMKYYGRAGLPGQATRLLLDMKGVYCCEPSFRSYNVVLDVLVVGNCP 191 Query: 82 AVAPNIFYEMLRKGVSPTVFTFGVVMK 2 +VA N+FY+ML KGVSP +TFG+VMK Sbjct: 192 SVASNVFYDMLSKGVSPNDYTFGLVMK 218