BLASTX nr result
ID: Angelica22_contig00037956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00037956 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637626.1| Pentatricopeptide repeat-containing protein ... 59 4e-07 ref|XP_003637381.1| Pentatricopeptide repeat-containing protein ... 59 4e-07 ref|XP_002873691.1| pentatricopeptide repeat-containing protein ... 57 2e-06 sp|Q9LER0.2|PP381_ARATH RecName: Full=Pentatricopeptide repeat-c... 55 8e-06 ref|NP_196981.1| pentatricopeptide repeat-containing protein [Ar... 55 8e-06 >ref|XP_003637626.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355503561|gb|AES84764.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 989 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/68 (48%), Positives = 42/68 (61%) Frame = -3 Query: 204 TAENLYPYLFYTLIHLFLSCRRLSKAIEAFTAMRNHDIVPELASWNQLLREFNDAGLVSQ 25 T +LY F TLI L+L+ R S A F+ MR +VP L WN LL +FN +GLVSQ Sbjct: 53 TKTHLYVSFFCTLIRLYLTHDRFSTASATFSHMRALGLVPTLPFWNTLLYQFNASGLVSQ 112 Query: 24 VWNVYSEM 1 V +YS+M Sbjct: 113 VKLMYSDM 120 >ref|XP_003637381.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355503316|gb|AES84519.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1023 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/68 (48%), Positives = 42/68 (61%) Frame = -3 Query: 204 TAENLYPYLFYTLIHLFLSCRRLSKAIEAFTAMRNHDIVPELASWNQLLREFNDAGLVSQ 25 T +LY F TLI L+L+ R S A F+ MR +VP L WN LL +FN +GLVSQ Sbjct: 53 TKTHLYVSFFCTLIRLYLTHDRFSTASATFSHMRALGLVPTLPFWNTLLYQFNASGLVSQ 112 Query: 24 VWNVYSEM 1 V +YS+M Sbjct: 113 VKLMYSDM 120 >ref|XP_002873691.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319528|gb|EFH49950.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 938 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/65 (47%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Frame = -3 Query: 192 LYPYLFYTLIHLFLSCRRLSKAIEAFTAMRNHDIVPELASWNQLLREFNDAGLV-SQVWN 16 +Y LF+TL L+LSC RL A +AM +VP+L WN L+ +FN GLV QV Sbjct: 56 VYVSLFHTLFRLYLSCGRLYGAARTLSAMCTFGVVPDLCLWNSLIHQFNVNGLVHDQVSL 115 Query: 15 VYSEM 1 VYS+M Sbjct: 116 VYSKM 120 >sp|Q9LER0.2|PP381_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g14770, mitochondrial; Flags: Precursor Length = 940 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Frame = -3 Query: 192 LYPYLFYTLIHLFLSCRRLSKAIEAFTAMRNHDIVPELASWNQLLREFNDAGLV-SQVWN 16 +Y LF+TL L+LSC RL A +AM +VP+ WN L+ +FN GLV QV Sbjct: 58 VYVSLFHTLFRLYLSCERLYGAARTLSAMCTFGVVPDSRLWNSLIHQFNVNGLVHDQVSL 117 Query: 15 VYSEM 1 +YS+M Sbjct: 118 IYSKM 122 >ref|NP_196981.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|9755745|emb|CAC01876.1| putative protein [Arabidopsis thaliana] gi|332004692|gb|AED92075.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 938 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/65 (44%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Frame = -3 Query: 192 LYPYLFYTLIHLFLSCRRLSKAIEAFTAMRNHDIVPELASWNQLLREFNDAGLV-SQVWN 16 +Y LF+TL L+LSC RL A +AM +VP+ WN L+ +FN GLV QV Sbjct: 56 VYVSLFHTLFRLYLSCERLYGAARTLSAMCTFGVVPDSRLWNSLIHQFNVNGLVHDQVSL 115 Query: 15 VYSEM 1 +YS+M Sbjct: 116 IYSKM 120