BLASTX nr result
ID: Angelica22_contig00037742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00037742 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003628421.1| hypothetical protein MTR_8g057760 [Medicago ... 72 6e-11 >ref|XP_003628421.1| hypothetical protein MTR_8g057760 [Medicago truncatula] gi|355522443|gb|AET02897.1| hypothetical protein MTR_8g057760 [Medicago truncatula] Length = 457 Score = 71.6 bits (174), Expect = 6e-11 Identities = 37/63 (58%), Positives = 41/63 (65%) Frame = +3 Query: 45 CPSQFPIQFPSPWRSFPIVSCNSARIDYHAWHKRLGHPNNDVLRGLLKSGVLGNKKLSSL 224 C QF QF S P+ SCNSA +DY WHKRLGHPN +VL LLKS LGNK SL Sbjct: 376 CQVQFS-QFGCLVLSLPLFSCNSAIVDYQVWHKRLGHPNTNVLHQLLKSNFLGNKHTPSL 434 Query: 225 SSV 233 +SV Sbjct: 435 NSV 437