BLASTX nr result
ID: Angelica22_contig00037738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00037738 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530516.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 ref|XP_002308454.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002530516.1| conserved hypothetical protein [Ricinus communis] gi|223529920|gb|EEF31848.1| conserved hypothetical protein [Ricinus communis] Length = 82 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = +2 Query: 194 MVVWSYPPTPKQLAVSAVFFLTGATLIGVGVHLSFTNIAPQQAR 325 MV+WSYPPT QL V+ + GA+LI G HLS N+APQQAR Sbjct: 21 MVLWSYPPTKNQLLVTVGLAIAGASLIAYGAHLSLVNVAPQQAR 64 >ref|XP_002308454.1| predicted protein [Populus trichocarpa] gi|222854430|gb|EEE91977.1| predicted protein [Populus trichocarpa] Length = 61 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = +2 Query: 197 VVWSYPPTPKQLAVSAVFFLTGATLIGVGVHLSFTNIAPQQAR 325 ++W+YPPT KQLA + FLTGA+L G ++S NIAPQQAR Sbjct: 1 MIWAYPPTRKQLAATVGLFLTGASLSVYGAYMSLANIAPQQAR 43