BLASTX nr result
ID: Angelica22_contig00037625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00037625 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003618284.1| Carbonic anhydrase [Medicago truncatula] gi|... 122 4e-26 ref|XP_003618283.1| Carbonic anhydrase [Medicago truncatula] gi|... 122 4e-26 ref|XP_003618280.1| Carbonic anhydrase [Medicago truncatula] gi|... 122 4e-26 ref|XP_003618281.1| Carbonic anhydrase [Medicago truncatula] gi|... 122 4e-26 gb|AAA34057.1| carbonic anhydrase, partial [Nicotiana tabacum] 120 9e-26 >ref|XP_003618284.1| Carbonic anhydrase [Medicago truncatula] gi|355493299|gb|AES74502.1| Carbonic anhydrase [Medicago truncatula] Length = 260 Score = 122 bits (305), Expect = 4e-26 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = +1 Query: 13 PFGDKCTLCEKEAVNVSLGNLLSYPFVRQGLVNKTLALKGGYYDFVKGSFELWGLEFGLS 192 PFG+ CT CEKEAVNVSLGNLL+YPFVR+GLVNKTLALKGGYYDFVKGSFELWGLEFGLS Sbjct: 196 PFGELCTHCEKEAVNVSLGNLLTYPFVREGLVNKTLALKGGYYDFVKGSFELWGLEFGLS 255 Query: 193 PSLSV 207 + SV Sbjct: 256 STFSV 260 >ref|XP_003618283.1| Carbonic anhydrase [Medicago truncatula] gi|355493298|gb|AES74501.1| Carbonic anhydrase [Medicago truncatula] Length = 185 Score = 122 bits (305), Expect = 4e-26 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = +1 Query: 13 PFGDKCTLCEKEAVNVSLGNLLSYPFVRQGLVNKTLALKGGYYDFVKGSFELWGLEFGLS 192 PFG+ CT CEKEAVNVSLGNLL+YPFVR+GLVNKTLALKGGYYDFVKGSFELWGLEFGLS Sbjct: 110 PFGELCTHCEKEAVNVSLGNLLTYPFVREGLVNKTLALKGGYYDFVKGSFELWGLEFGLS 169 Query: 193 PSLSV 207 + SV Sbjct: 170 STFSV 174 >ref|XP_003618280.1| Carbonic anhydrase [Medicago truncatula] gi|355493295|gb|AES74498.1| Carbonic anhydrase [Medicago truncatula] Length = 342 Score = 122 bits (305), Expect = 4e-26 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = +1 Query: 13 PFGDKCTLCEKEAVNVSLGNLLSYPFVRQGLVNKTLALKGGYYDFVKGSFELWGLEFGLS 192 PFG+ CT CEKEAVNVSLGNLL+YPFVR+GLVNKTLALKGGYYDFVKGSFELWGLEFGLS Sbjct: 267 PFGELCTHCEKEAVNVSLGNLLTYPFVREGLVNKTLALKGGYYDFVKGSFELWGLEFGLS 326 Query: 193 PSLSV 207 + SV Sbjct: 327 STFSV 331 >ref|XP_003618281.1| Carbonic anhydrase [Medicago truncatula] gi|355493296|gb|AES74499.1| Carbonic anhydrase [Medicago truncatula] Length = 331 Score = 122 bits (305), Expect = 4e-26 Identities = 57/65 (87%), Positives = 61/65 (93%) Frame = +1 Query: 13 PFGDKCTLCEKEAVNVSLGNLLSYPFVRQGLVNKTLALKGGYYDFVKGSFELWGLEFGLS 192 PFG+ CT CEKEAVNVSLGNLL+YPFVR+GLVNKTLALKGGYYDFVKGSFELWGLEFGLS Sbjct: 267 PFGELCTHCEKEAVNVSLGNLLTYPFVREGLVNKTLALKGGYYDFVKGSFELWGLEFGLS 326 Query: 193 PSLSV 207 + SV Sbjct: 327 STFSV 331 >gb|AAA34057.1| carbonic anhydrase, partial [Nicotiana tabacum] Length = 264 Score = 120 bits (302), Expect = 9e-26 Identities = 56/64 (87%), Positives = 60/64 (93%) Frame = +1 Query: 16 FGDKCTLCEKEAVNVSLGNLLSYPFVRQGLVNKTLALKGGYYDFVKGSFELWGLEFGLSP 195 FGD+CT CEKEAVNVSLGNLL+YPFVR+GLV KTLALKGG+YDFV G FELWGLEFGLSP Sbjct: 201 FGDQCTACEKEAVNVSLGNLLTYPFVREGLVKKTLALKGGHYDFVNGGFELWGLEFGLSP 260 Query: 196 SLSV 207 SLSV Sbjct: 261 SLSV 264