BLASTX nr result
ID: Angelica22_contig00037557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00037557 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515331.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_002320323.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002515331.1| conserved hypothetical protein [Ricinus communis] gi|223545811|gb|EEF47315.1| conserved hypothetical protein [Ricinus communis] Length = 156 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/44 (52%), Positives = 32/44 (72%) Frame = +3 Query: 222 MEGVSTKVYKGLKGYWRRRGYQRISRSGRKRVIPAIHLGSGGST 353 MEGVS +Y ++ YWRRRGYQR++ SGR+R + + LG G +T Sbjct: 1 MEGVSASMYTKIRSYWRRRGYQRLNESGRRRRMNTVELGGGSAT 44 >ref|XP_002320323.1| predicted protein [Populus trichocarpa] gi|222861096|gb|EEE98638.1| predicted protein [Populus trichocarpa] Length = 148 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +3 Query: 222 MEGVSTKVYKGLKGYWRRRGYQRISRSGRKRVIPAIHLGSGGSTRKTR 365 MEG+S +Y +KGYW RRGY+RI+ SGR R + LGSG ST + R Sbjct: 1 MEGISASMYTKMKGYWSRRGYERINGSGRIRRKRPVELGSGSSTSRGR 48