BLASTX nr result
ID: Angelica22_contig00037420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00037420 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containi... 69 3e-10 ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 61 8e-08 ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_003567522.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 gb|EAY77393.1| hypothetical protein OsI_05381 [Oryza sativa Indi... 57 2e-06 >ref|XP_004138087.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] gi|449524136|ref|XP_004169079.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cucumis sativus] Length = 632 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -1 Query: 321 SLFQEGRYSEAKDLLYKCPLHIRKHKAICSLFGSLETRTTASS 193 S F EGRYSEAKDLL+KCP HIRKH +C LFGS E+ TTA++ Sbjct: 581 SFFNEGRYSEAKDLLFKCPHHIRKHNEVCKLFGSAESNTTAAT 623 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Vitis vinifera] Length = 631 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 321 SLFQEGRYSEAKDLLYKCPLHIRKHKAICSLFGSLET 211 S FQEGR SEAKDLLYKCP HIRKH IC LFGS ++ Sbjct: 588 SFFQEGRESEAKDLLYKCPHHIRKHPDICKLFGSAKS 624 >ref|XP_003550712.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Glycine max] Length = 635 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 321 SLFQEGRYSEAKDLLYKCPLHIRKHKAICSLFGSLETRT 205 SLF+EGR SEAKDLLYK P HIR H IC LFGS ET++ Sbjct: 587 SLFREGRLSEAKDLLYKTPHHIRTHSKICKLFGSSETKS 625 >ref|XP_003567522.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Brachypodium distachyon] Length = 585 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -1 Query: 321 SLFQEGRYSEAKDLLYKCPLHIRKHKAICSLFGSLETRTTA 199 S F EGRYSEA+DLLYKCP+HIR+H I LF S++ TT+ Sbjct: 545 SFFAEGRYSEAQDLLYKCPIHIRRHHDITKLFESIKVETTS 585 >gb|EAY77393.1| hypothetical protein OsI_05381 [Oryza sativa Indica Group] Length = 573 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/43 (55%), Positives = 32/43 (74%) Frame = -1 Query: 321 SLFQEGRYSEAKDLLYKCPLHIRKHKAICSLFGSLETRTTASS 193 S F EGRYSEA+DLLYKCP HIRKH + LF S++ + +++ Sbjct: 531 SFFTEGRYSEAQDLLYKCPFHIRKHPDVTELFESIKVESESAA 573