BLASTX nr result
ID: Angelica22_contig00037325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00037325 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588364.1| F-box/FBD/LRR-repeat protein, partial [Medic... 57 2e-06 >ref|XP_003588364.1| F-box/FBD/LRR-repeat protein, partial [Medicago truncatula] gi|355477412|gb|AES58615.1| F-box/FBD/LRR-repeat protein, partial [Medicago truncatula] Length = 100 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +3 Query: 195 RINELPQEDIISELPQHIRETIVGFLPIREAVRTSVLSRKWRHCW 329 ++++ D+IS+LPQ I ETI+ LPIR+AVRTS+LSRKWR+ W Sbjct: 7 KMDDFSGPDLISDLPQSIIETILIQLPIRDAVRTSILSRKWRYKW 51