BLASTX nr result
ID: Angelica22_contig00037002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00037002 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276812.2| PREDICTED: cytochrome P450 71A4 [Vitis vinif... 62 5e-08 emb|CBI14925.3| unnamed protein product [Vitis vinifera] 62 5e-08 emb|CAN67678.1| hypothetical protein VITISV_035274 [Vitis vinifera] 62 5e-08 ref|XP_002511294.1| cytochrome P450, putative [Ricinus communis]... 61 8e-08 ref|XP_003541540.1| PREDICTED: cytochrome P450 71A24-like [Glyci... 60 2e-07 >ref|XP_002276812.2| PREDICTED: cytochrome P450 71A4 [Vitis vinifera] Length = 488 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 292 ANLLHKFDWKLPDGRNGEDLDLSERPSLTIQRKVPLLAVATSC 164 ANL++KFDW LPDG EDLD++E LTI RK PLLAV+T C Sbjct: 445 ANLVNKFDWALPDGARAEDLDMTECTGLTIHRKFPLLAVSTPC 487 >emb|CBI14925.3| unnamed protein product [Vitis vinifera] Length = 457 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 292 ANLLHKFDWKLPDGRNGEDLDLSERPSLTIQRKVPLLAVATSC 164 ANL++KFDW LPDG EDLD++E LTI RK PLLAV+T C Sbjct: 414 ANLVNKFDWALPDGARAEDLDMTECTGLTIHRKFPLLAVSTPC 456 >emb|CAN67678.1| hypothetical protein VITISV_035274 [Vitis vinifera] Length = 505 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 292 ANLLHKFDWKLPDGRNGEDLDLSERPSLTIQRKVPLLAVATSC 164 ANL++KFDW LPDG EDLD++E LTI RK PLLAV+T C Sbjct: 462 ANLVNKFDWALPDGARAEDLDMTECTGLTIHRKFPLLAVSTPC 504 >ref|XP_002511294.1| cytochrome P450, putative [Ricinus communis] gi|223550409|gb|EEF51896.1| cytochrome P450, putative [Ricinus communis] Length = 508 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 292 ANLLHKFDWKLPDGRNGEDLDLSERPSLTIQRKVPLLAVAT 170 ANLLHKFDW LPDG +DLD++E LT+ RK PLLAVAT Sbjct: 464 ANLLHKFDWALPDGVKEDDLDMTESVGLTVHRKFPLLAVAT 504 >ref|XP_003541540.1| PREDICTED: cytochrome P450 71A24-like [Glycine max] Length = 501 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/42 (64%), Positives = 31/42 (73%) Frame = -3 Query: 292 ANLLHKFDWKLPDGRNGEDLDLSERPSLTIQRKVPLLAVATS 167 ANL+H+FDW LP G GEDLD+SE P L RK PL AVAT+ Sbjct: 456 ANLVHQFDWSLPGGAAGEDLDMSETPGLAANRKYPLYAVATA 497