BLASTX nr result
ID: Angelica22_contig00036939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00036939 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34116.3| unnamed protein product [Vitis vinifera] 121 7e-26 ref|XP_002268064.1| PREDICTED: pentatricopeptide repeat-containi... 121 7e-26 ref|XP_002514422.1| pentatricopeptide repeat-containing protein,... 114 8e-24 ref|XP_002525881.1| pentatricopeptide repeat-containing protein,... 112 3e-23 ref|XP_003525573.1| PREDICTED: pentatricopeptide repeat-containi... 110 9e-23 >emb|CBI34116.3| unnamed protein product [Vitis vinifera] Length = 727 Score = 121 bits (303), Expect = 7e-26 Identities = 57/101 (56%), Positives = 74/101 (73%) Frame = -3 Query: 305 RGCMPSILTCNYLMNRLVECRKMDMVVSLYLQLKRLGFTPNVYTYGIVIKALCRKGEMED 126 RG +P I++CN+LMNRL+E K+DM V++Y LKRLG PN YTYGI IKALCRKG E+ Sbjct: 186 RGFVPHIMSCNFLMNRLIEHGKIDMAVAIYRHLKRLGLNPNDYTYGIFIKALCRKGNFEE 245 Query: 125 ATYVLYEMDQAQVEPDVFIYTSYIDGLCSHGTSVLGYDMLK 3 A V EM++A V P+ ++YI+GLCSH S LGY+ L+ Sbjct: 246 AVDVFREMEEAGVNPNAVTCSTYIEGLCSHKRSDLGYEALR 286 >ref|XP_002268064.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial [Vitis vinifera] Length = 817 Score = 121 bits (303), Expect = 7e-26 Identities = 57/101 (56%), Positives = 74/101 (73%) Frame = -3 Query: 305 RGCMPSILTCNYLMNRLVECRKMDMVVSLYLQLKRLGFTPNVYTYGIVIKALCRKGEMED 126 RG +P I++CN+LMNRL+E K+DM V++Y LKRLG PN YTYGI IKALCRKG E+ Sbjct: 186 RGFVPHIMSCNFLMNRLIEHGKIDMAVAIYRHLKRLGLNPNDYTYGIFIKALCRKGNFEE 245 Query: 125 ATYVLYEMDQAQVEPDVFIYTSYIDGLCSHGTSVLGYDMLK 3 A V EM++A V P+ ++YI+GLCSH S LGY+ L+ Sbjct: 246 AVDVFREMEEAGVNPNAVTCSTYIEGLCSHKRSDLGYEALR 286 >ref|XP_002514422.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546418|gb|EEF47918.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 809 Score = 114 bits (285), Expect = 8e-24 Identities = 52/100 (52%), Positives = 71/100 (71%) Frame = -3 Query: 302 GCMPSILTCNYLMNRLVECRKMDMVVSLYLQLKRLGFTPNVYTYGIVIKALCRKGEMEDA 123 G P IL+CN+LMNRLVE RK+DM +++Y QLK G PN YTY I IK CRKG + +A Sbjct: 179 GFAPQILSCNFLMNRLVESRKVDMAIAIYRQLKAFGLNPNDYTYTIAIKGFCRKGNLAEA 238 Query: 122 TYVLYEMDQAQVEPDVFIYTSYIDGLCSHGTSVLGYDMLK 3 V +M+++ V P+ F YT++I+GLC HG S LG+ +L+ Sbjct: 239 IDVFRDMEESGVTPNSFSYTTFIEGLCLHGRSDLGFKVLQ 278 >ref|XP_002525881.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223534795|gb|EEF36485.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 913 Score = 112 bits (280), Expect = 3e-23 Identities = 52/101 (51%), Positives = 73/101 (72%) Frame = -3 Query: 305 RGCMPSILTCNYLMNRLVECRKMDMVVSLYLQLKRLGFTPNVYTYGIVIKALCRKGEMED 126 R +P I CN+LMN L++ K+DM +++Y QLKRLG +PN YTY IVIKALC G +E+ Sbjct: 192 RRFVPHIFICNFLMNSLIKNSKLDMALAVYKQLKRLGLSPNDYTYAIVIKALCINGSLEE 251 Query: 125 ATYVLYEMDQAQVEPDVFIYTSYIDGLCSHGTSVLGYDMLK 3 A YV+ EM+++ + P F YT+YI+GLC + S LGY +L+ Sbjct: 252 AMYVIKEMEESGITPTGFAYTAYIEGLCVNEMSDLGYQVLQ 292 >ref|XP_003525573.1| PREDICTED: pentatricopeptide repeat-containing protein At2g26790, mitochondrial-like [Glycine max] Length = 819 Score = 110 bits (276), Expect = 9e-23 Identities = 50/101 (49%), Positives = 73/101 (72%) Frame = -3 Query: 305 RGCMPSILTCNYLMNRLVECRKMDMVVSLYLQLKRLGFTPNVYTYGIVIKALCRKGEMED 126 RG +P +LTCN+L NRLVE ++D +++Y QLKR GF PN YTY IVIKALC+KG+++ Sbjct: 189 RGILPDVLTCNFLFNRLVEHGEVDKALAVYEQLKRFGFIPNCYTYAIVIKALCKKGDLKQ 248 Query: 125 ATYVLYEMDQAQVEPDVFIYTSYIDGLCSHGTSVLGYDMLK 3 V EM++ V P + + +YI+GLC++ S LGY++L+ Sbjct: 249 PLCVFEEMERVGVIPHSYCFAAYIEGLCNNHRSDLGYEVLQ 289