BLASTX nr result
ID: Angelica22_contig00036183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00036183 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268811.1| PREDICTED: nucleobase-ascorbate transporter ... 86 4e-15 ref|XP_002315809.1| nucleobase ascorbate transporter [Populus tr... 83 3e-14 ref|XP_002444345.1| hypothetical protein SORBIDRAFT_07g020510 [S... 81 8e-14 ref|XP_002311584.1| nucleobase ascorbate transporter [Populus tr... 81 8e-14 ref|NP_001141421.1| uncharacterized protein LOC100273531 [Zea ma... 81 8e-14 >ref|XP_002268811.1| PREDICTED: nucleobase-ascorbate transporter 6 [Vitis vinifera] gi|296086499|emb|CBI32088.3| unnamed protein product [Vitis vinifera] Length = 541 Score = 85.5 bits (210), Expect = 4e-15 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 133 GGGHAPPPKQEELLPHPAKDQLPNIAFCITSPPPWPEA 246 GGGHAPPPKQ+EL PHPAKDQLPNIA+CITSPPPWPEA Sbjct: 11 GGGHAPPPKQDELQPHPAKDQLPNIAYCITSPPPWPEA 48 >ref|XP_002315809.1| nucleobase ascorbate transporter [Populus trichocarpa] gi|222864849|gb|EEF01980.1| nucleobase ascorbate transporter [Populus trichocarpa] Length = 534 Score = 82.8 bits (203), Expect = 3e-14 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 133 GGGHAPPPKQEELLPHPAKDQLPNIAFCITSPPPWPEA 246 GGG APPPKQEEL PHPAKDQLPNIA+CITSPPPWPEA Sbjct: 4 GGGAAPPPKQEELQPHPAKDQLPNIAYCITSPPPWPEA 41 >ref|XP_002444345.1| hypothetical protein SORBIDRAFT_07g020510 [Sorghum bicolor] gi|241940695|gb|EES13840.1| hypothetical protein SORBIDRAFT_07g020510 [Sorghum bicolor] Length = 533 Score = 81.3 bits (199), Expect = 8e-14 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +1 Query: 127 MAGGGHAPPPKQEELLPHPAKDQLPNIAFCITSPPPWPEA 246 MAGGG APPPKQEEL PHP KDQLP++++CITSPPPWPEA Sbjct: 1 MAGGGAAPPPKQEELQPHPVKDQLPSVSYCITSPPPWPEA 40 >ref|XP_002311584.1| nucleobase ascorbate transporter [Populus trichocarpa] gi|222851404|gb|EEE88951.1| nucleobase ascorbate transporter [Populus trichocarpa] Length = 534 Score = 81.3 bits (199), Expect = 8e-14 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 133 GGGHAPPPKQEELLPHPAKDQLPNIAFCITSPPPWPEA 246 GGG APPPKQEEL PHP KDQLPNIA+CITSPPPWPEA Sbjct: 4 GGGPAPPPKQEELQPHPVKDQLPNIAYCITSPPPWPEA 41 >ref|NP_001141421.1| uncharacterized protein LOC100273531 [Zea mays] gi|194704530|gb|ACF86349.1| unknown [Zea mays] gi|195616494|gb|ACG30077.1| permease [Zea mays] gi|414870575|tpg|DAA49132.1| TPA: permease [Zea mays] Length = 533 Score = 81.3 bits (199), Expect = 8e-14 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +1 Query: 127 MAGGGHAPPPKQEELLPHPAKDQLPNIAFCITSPPPWPEA 246 MAGGG APPPKQEEL PHP KDQLP++++CITSPPPWPEA Sbjct: 1 MAGGGAAPPPKQEELQPHPVKDQLPSVSYCITSPPPWPEA 40