BLASTX nr result
ID: Angelica22_contig00036032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00036032 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513622.1| Tellurite resistance protein tehA, putative ... 139 3e-31 ref|XP_003619272.1| C4-dicarboxylate transporter/malic acid tran... 136 2e-30 ref|XP_003619241.1| C4-dicarboxylate transporter/malic acid tran... 136 2e-30 ref|XP_003549003.1| PREDICTED: S-type anion channel SLAH3-like [... 136 2e-30 ref|XP_003619247.1| hypothetical protein MTR_6g045200 [Medicago ... 135 3e-30 >ref|XP_002513622.1| Tellurite resistance protein tehA, putative [Ricinus communis] gi|223547530|gb|EEF49025.1| Tellurite resistance protein tehA, putative [Ricinus communis] Length = 616 Score = 139 bits (349), Expect = 3e-31 Identities = 67/69 (97%), Positives = 69/69 (100%) Frame = +2 Query: 2 GLAHYTVLFVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMAWAKIQGSFDFGSRIAFF 181 GLAHYTVLFVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMAWAKIQGSFD+GSRIA+F Sbjct: 408 GLAHYTVLFVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMAWAKIQGSFDYGSRIAYF 467 Query: 182 IALFLYFSL 208 IALFLYFSL Sbjct: 468 IALFLYFSL 476 >ref|XP_003619272.1| C4-dicarboxylate transporter/malic acid transport protein [Medicago truncatula] gi|355494287|gb|AES75490.1| C4-dicarboxylate transporter/malic acid transport protein [Medicago truncatula] Length = 451 Score = 136 bits (343), Expect = 2e-30 Identities = 66/69 (95%), Positives = 68/69 (98%) Frame = +2 Query: 2 GLAHYTVLFVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMAWAKIQGSFDFGSRIAFF 181 GLAHYTVLFVTLYQRLPTN TLPKELHPVFFLFVAAPSVASMAWAKIQGSFD+GSRIA+F Sbjct: 165 GLAHYTVLFVTLYQRLPTNATLPKELHPVFFLFVAAPSVASMAWAKIQGSFDYGSRIAYF 224 Query: 182 IALFLYFSL 208 IALFLYFSL Sbjct: 225 IALFLYFSL 233 >ref|XP_003619241.1| C4-dicarboxylate transporter/malic acid transport protein [Medicago truncatula] gi|355494256|gb|AES75459.1| C4-dicarboxylate transporter/malic acid transport protein [Medicago truncatula] Length = 800 Score = 136 bits (343), Expect = 2e-30 Identities = 66/69 (95%), Positives = 68/69 (98%) Frame = +2 Query: 2 GLAHYTVLFVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMAWAKIQGSFDFGSRIAFF 181 GLAHYTVLFVTLYQRLPTN TLPKELHPVFFLFVAAPSVASMAWAKIQGSFD+GSRIA+F Sbjct: 610 GLAHYTVLFVTLYQRLPTNATLPKELHPVFFLFVAAPSVASMAWAKIQGSFDYGSRIAYF 669 Query: 182 IALFLYFSL 208 IALFLYFSL Sbjct: 670 IALFLYFSL 678 >ref|XP_003549003.1| PREDICTED: S-type anion channel SLAH3-like [Glycine max] Length = 597 Score = 136 bits (342), Expect = 2e-30 Identities = 65/69 (94%), Positives = 68/69 (98%) Frame = +2 Query: 2 GLAHYTVLFVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMAWAKIQGSFDFGSRIAFF 181 GLAHYTV+FVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMAWA IQGSFD+GSRIA+F Sbjct: 392 GLAHYTVMFVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMAWANIQGSFDYGSRIAYF 451 Query: 182 IALFLYFSL 208 IALFLYFSL Sbjct: 452 IALFLYFSL 460 >ref|XP_003619247.1| hypothetical protein MTR_6g045200 [Medicago truncatula] gi|355494262|gb|AES75465.1| hypothetical protein MTR_6g045200 [Medicago truncatula] Length = 605 Score = 135 bits (340), Expect = 3e-30 Identities = 65/69 (94%), Positives = 68/69 (98%) Frame = +2 Query: 2 GLAHYTVLFVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMAWAKIQGSFDFGSRIAFF 181 GLAHY VLFVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMAWAK+QGSFD+GSRIA+F Sbjct: 398 GLAHYIVLFVTLYQRLPTNETLPKELHPVFFLFVAAPSVASMAWAKMQGSFDYGSRIAYF 457 Query: 182 IALFLYFSL 208 IALFLYFSL Sbjct: 458 IALFLYFSL 466