BLASTX nr result
ID: Angelica22_contig00035950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00035950 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323915.1| hypothetical protein POPTRDRAFT_825456 [Popu... 58 7e-07 ref|XP_002309738.1| hypothetical protein POPTRDRAFT_216196 [Popu... 57 2e-06 ref|XP_002278433.2| PREDICTED: BTB/POZ and TAZ domain-containing... 55 8e-06 emb|CBI24713.3| unnamed protein product [Vitis vinifera] 55 8e-06 emb|CAN79405.1| hypothetical protein VITISV_000709 [Vitis vinifera] 55 8e-06 >ref|XP_002323915.1| hypothetical protein POPTRDRAFT_825456 [Populus trichocarpa] gi|222866917|gb|EEF04048.1| hypothetical protein POPTRDRAFT_825456 [Populus trichocarpa] Length = 363 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 402 FKVKMSKQSKKDAAKWKLLVSKVVAAKIALGPFSPR 295 FK KM +Q+KKD AKWKLLVSKV+AAK ALGPFS R Sbjct: 323 FKEKMQQQTKKDEAKWKLLVSKVIAAKNALGPFSAR 358 >ref|XP_002309738.1| hypothetical protein POPTRDRAFT_216196 [Populus trichocarpa] gi|222852641|gb|EEE90188.1| hypothetical protein POPTRDRAFT_216196 [Populus trichocarpa] Length = 355 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 402 FKVKMSKQSKKDAAKWKLLVSKVVAAKIALGPFSPR 295 FK KM +Q+KK+ AKWKLLVSKV+AAK ALGPFS R Sbjct: 320 FKEKMQQQTKKEEAKWKLLVSKVIAAKNALGPFSAR 355 >ref|XP_002278433.2| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Vitis vinifera] Length = 410 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -1 Query: 402 FKVKMSKQSKKDAAKWKLLVSKVVAAKIALGPFSPRQS 289 FK KM +QSKKD KWKLLVSKV+A K +LGPF R S Sbjct: 370 FKEKMQQQSKKDETKWKLLVSKVIAVKNSLGPFPARSS 407 >emb|CBI24713.3| unnamed protein product [Vitis vinifera] Length = 407 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -1 Query: 402 FKVKMSKQSKKDAAKWKLLVSKVVAAKIALGPFSPRQS 289 FK KM +QSKKD KWKLLVSKV+A K +LGPF R S Sbjct: 367 FKEKMQQQSKKDETKWKLLVSKVIAVKNSLGPFPARSS 404 >emb|CAN79405.1| hypothetical protein VITISV_000709 [Vitis vinifera] Length = 306 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -1 Query: 402 FKVKMSKQSKKDAAKWKLLVSKVVAAKIALGPFSPRQS 289 FK KM +QSKKD KWKLLVSKV+A K +LGPF R S Sbjct: 266 FKEKMQQQSKKDETKWKLLVSKVIAVKNSLGPFPARSS 303