BLASTX nr result
ID: Angelica22_contig00035949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00035949 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63634.1| hypothetical protein VITISV_009388 [Vitis vinifera] 61 8e-08 ref|XP_002523188.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 ref|XP_002263371.1| PREDICTED: monoglyceride lipase-like [Vitis ... 57 1e-06 >emb|CAN63634.1| hypothetical protein VITISV_009388 [Vitis vinifera] Length = 328 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 346 IFEGMWHMLIGEPNEGVETVFQTIVSWIGERADKA 242 IF GMWH LIGEP EGVE VF TI+SWIG RA+KA Sbjct: 283 IFPGMWHQLIGEPKEGVELVFGTILSWIGSRAEKA 317 >ref|XP_002523188.1| conserved hypothetical protein [Ricinus communis] gi|223537595|gb|EEF39219.1| conserved hypothetical protein [Ricinus communis] Length = 290 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -1 Query: 349 KIFEGMWHMLIGEPNEGVETVFQTIVSWIGERADKA 242 KIF GMWHMLIGEP E VE VF TI SW+G+ A KA Sbjct: 249 KIFPGMWHMLIGEPKENVELVFCTIFSWLGDHAAKA 284 >ref|XP_002263371.1| PREDICTED: monoglyceride lipase-like [Vitis vinifera] Length = 328 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -1 Query: 346 IFEGMWHMLIGEPNEGVETVFQTIVSWIGERADKA 242 IF GMWH LIGEP EGVE VF TI++WI RA+KA Sbjct: 283 IFPGMWHQLIGEPKEGVELVFGTILTWIDSRAEKA 317