BLASTX nr result
ID: Angelica22_contig00035941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00035941 (233 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519098.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 ref|XP_002281077.1| PREDICTED: cytochrome c biogenesis protein C... 55 8e-06 >ref|XP_002519098.1| conserved hypothetical protein [Ricinus communis] gi|223541761|gb|EEF43309.1| conserved hypothetical protein [Ricinus communis] Length = 556 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 194 KICALQDGTSMIIEGKTNPAKAKFPNAINRLLDQVPEIVAS 72 +I ALQDGTSM++ GKTN AK F + +NRLLDQVPEIV S Sbjct: 504 QIWALQDGTSMVVGGKTNRAKGVFEDEVNRLLDQVPEIVES 544 >ref|XP_002281077.1| PREDICTED: cytochrome c biogenesis protein CCS1, chloroplastic [Vitis vinifera] gi|297741415|emb|CBI32546.3| unnamed protein product [Vitis vinifera] Length = 557 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -1 Query: 194 KICALQDGTSMIIEGKTNPAKAKFPNAINRLLDQVPEIVAS 72 +I ALQDGT+++I GKTN AK +FP+ +N+LLD+VPE+V S Sbjct: 506 QIWALQDGTTVVIGGKTNRAKLEFPDEMNQLLDRVPELVES 546