BLASTX nr result
ID: Angelica22_contig00035729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00035729 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36825.3| unnamed protein product [Vitis vinifera] 140 1e-31 ref|XP_002263353.1| PREDICTED: putative indole-3-acetic acid-ami... 140 1e-31 ref|XP_002531876.1| Indole-3-acetic acid-amido synthetase GH3.17... 139 2e-31 ref|XP_003598911.1| Indole-3-acetic acid-amido synthetase GH3.5 ... 135 3e-30 ref|XP_003536201.1| PREDICTED: putative indole-3-acetic acid-ami... 134 6e-30 >emb|CBI36825.3| unnamed protein product [Vitis vinifera] Length = 548 Score = 140 bits (352), Expect = 1e-31 Identities = 65/80 (81%), Positives = 72/80 (90%) Frame = +3 Query: 3 EELDYNYRRCRANDKSIGPLEIRVVKPGTFESLMDLYISQGGSINQYKTPRCIKSNAALK 182 EELDY YRRCR +DKS+GPLEIR+V+PGTFE LMDL+ISQGGSINQYKTPRCIKS+ ALK Sbjct: 469 EELDYIYRRCRTHDKSVGPLEIRLVQPGTFEDLMDLFISQGGSINQYKTPRCIKSSNALK 528 Query: 183 LLESNVKARFFSPRDPTWTP 242 LL SNV+A FFSPRDP W P Sbjct: 529 LLNSNVEASFFSPRDPRWIP 548 >ref|XP_002263353.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9 [Vitis vinifera] Length = 596 Score = 140 bits (352), Expect = 1e-31 Identities = 65/80 (81%), Positives = 72/80 (90%) Frame = +3 Query: 3 EELDYNYRRCRANDKSIGPLEIRVVKPGTFESLMDLYISQGGSINQYKTPRCIKSNAALK 182 EELDY YRRCR +DKS+GPLEIR+V+PGTFE LMDL+ISQGGSINQYKTPRCIKS+ ALK Sbjct: 517 EELDYIYRRCRTHDKSVGPLEIRLVQPGTFEDLMDLFISQGGSINQYKTPRCIKSSNALK 576 Query: 183 LLESNVKARFFSPRDPTWTP 242 LL SNV+A FFSPRDP W P Sbjct: 577 LLNSNVEASFFSPRDPRWIP 596 >ref|XP_002531876.1| Indole-3-acetic acid-amido synthetase GH3.17, putative [Ricinus communis] gi|223528484|gb|EEF30513.1| Indole-3-acetic acid-amido synthetase GH3.17, putative [Ricinus communis] Length = 597 Score = 139 bits (350), Expect = 2e-31 Identities = 66/80 (82%), Positives = 71/80 (88%) Frame = +3 Query: 3 EELDYNYRRCRANDKSIGPLEIRVVKPGTFESLMDLYISQGGSINQYKTPRCIKSNAALK 182 EELDY YRRCR +DKSIGPLEIRVV+PGTFE+LMDL+I QGGSINQYKTPRCIKSNAAL Sbjct: 518 EELDYIYRRCRTHDKSIGPLEIRVVEPGTFEALMDLFIGQGGSINQYKTPRCIKSNAALM 577 Query: 183 LLESNVKARFFSPRDPTWTP 242 LL S+VKA FFS RDP W P Sbjct: 578 LLNSHVKASFFSARDPVWIP 597 >ref|XP_003598911.1| Indole-3-acetic acid-amido synthetase GH3.5 [Medicago truncatula] gi|355487959|gb|AES69162.1| Indole-3-acetic acid-amido synthetase GH3.5 [Medicago truncatula] Length = 128 Score = 135 bits (341), Expect = 3e-30 Identities = 63/80 (78%), Positives = 70/80 (87%) Frame = +3 Query: 3 EELDYNYRRCRANDKSIGPLEIRVVKPGTFESLMDLYISQGGSINQYKTPRCIKSNAALK 182 EELDY YRRCR NDKS+GPLEIRVV+PGTFE+LMDL+I++G SINQYKTPRCIKS ALK Sbjct: 48 EELDYVYRRCRTNDKSVGPLEIRVVEPGTFEALMDLFITKGASINQYKTPRCIKSKKALK 107 Query: 183 LLESNVKARFFSPRDPTWTP 242 LL+S V A FFSPRDP W P Sbjct: 108 LLKSKVSASFFSPRDPKWGP 127 >ref|XP_003536201.1| PREDICTED: putative indole-3-acetic acid-amido synthetase GH3.9-like [Glycine max] Length = 608 Score = 134 bits (338), Expect = 6e-30 Identities = 63/82 (76%), Positives = 72/82 (87%) Frame = +3 Query: 3 EELDYNYRRCRANDKSIGPLEIRVVKPGTFESLMDLYISQGGSINQYKTPRCIKSNAALK 182 E+LDY YRRCR+ DKS+GPLEIRVV+PGTF++LMDL+ISQG SINQYKTPRCIKS ALK Sbjct: 524 EQLDYVYRRCRSYDKSVGPLEIRVVEPGTFDALMDLFISQGASINQYKTPRCIKSKKALK 583 Query: 183 LLESNVKARFFSPRDPTWTP*M 248 LL+S V A FFSPRDP W+P M Sbjct: 584 LLKSKVTASFFSPRDPKWSPKM 605