BLASTX nr result
ID: Angelica22_contig00035726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00035726 (466 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003381638.1| ubiquitin family protein [Trichinella spiral... 65 4e-09 ref|XP_002323462.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_001896539.1| ubiquitin [Brugia malayi] gi|158596243|gb|ED... 63 2e-08 ref|XP_004173717.1| PREDICTED: polyubiquitin-like, partial [Cucu... 63 3e-08 ref|XP_004155670.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40... 63 3e-08 >ref|XP_003381638.1| ubiquitin family protein [Trichinella spiralis] gi|316979524|gb|EFV62308.1| ubiquitin family protein [Trichinella spiralis] Length = 274 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +2 Query: 2 QLEDGRTLADYNIQKESTLHLVLRLRGEIQLLVETP 109 QLEDGRTLADYNIQKESTLHLVLRLRG +Q+ V+TP Sbjct: 218 QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTP 253 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 2 QLEDGRTLADYNIQKESTLHLVLRLRGEIQLLVET 106 QLEDGRTL+DYNIQKESTLHLVLRLRG +Q+ V+T Sbjct: 58 QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKT 92 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 2 QLEDGRTLADYNIQKESTLHLVLRLRGEIQLLVET 106 QLEDGR L+DYNIQKESTLHLVLRLRG +Q+ V+T Sbjct: 134 QLEDGRMLSDYNIQKESTLHLVLRLRGGMQIFVKT 168 >ref|XP_002323462.1| predicted protein [Populus trichocarpa] gi|222868092|gb|EEF05223.1| predicted protein [Populus trichocarpa] Length = 115 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +2 Query: 2 QLEDGRTLADYNIQKESTLHLVLRLRGEIQLLVET 106 QLEDGRTLADYNIQKESTLHLVLRLRG IQ+ V+T Sbjct: 17 QLEDGRTLADYNIQKESTLHLVLRLRGGIQIFVKT 51 >ref|XP_001896539.1| ubiquitin [Brugia malayi] gi|158596243|gb|EDP34630.1| ubiquitin, putative [Brugia malayi] Length = 307 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 2 QLEDGRTLADYNIQKESTLHLVLRLRGEIQLLVETPATM 118 QLEDGRTL+DYNIQKESTLHLVLRLRG +Q+ V+T +M Sbjct: 125 QLEDGRTLSDYNIQKESTLHLVLRLRGGLQIFVKTLTSM 163 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +2 Query: 2 QLEDGRTLADYNIQKESTLHLVLRLRGEIQLLVET 106 QLEDGRTL+DYNIQKESTLHLVLRLRG +Q+ V+T Sbjct: 49 QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKT 83 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 2 QLEDGRTLADYNIQKESTLHLVLRLRGEIQLLVET 106 QLEDGRT +DYNIQKESTLHLVLRLRG +Q+ V+T Sbjct: 203 QLEDGRTFSDYNIQKESTLHLVLRLRGGMQIFVKT 237 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 QLEDGRTLADYNIQKESTLHLVLRLRG 82 QLEDGRTL+DYNIQKESTLHLVLRLRG Sbjct: 279 QLEDGRTLSDYNIQKESTLHLVLRLRG 305 >ref|XP_004173717.1| PREDICTED: polyubiquitin-like, partial [Cucumis sativus] Length = 126 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 2 QLEDGRTLADYNIQKESTLHLVLRLRGEIQLLVET 106 QLEDGRTLADYNIQKESTLHLVLRLRG +Q+ V+T Sbjct: 22 QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT 56 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 QLEDGRTLADYNIQKESTLHLVLRLRG 82 QLEDGRTLADYNIQKESTLHLVLRLRG Sbjct: 98 QLEDGRTLADYNIQKESTLHLVLRLRG 124 >ref|XP_004155670.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-40S ribosomal protein S27a-like [Cucumis sativus] Length = 228 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +2 Query: 2 QLEDGRTLADYNIQKESTLHLVLRLRGEIQLLVET 106 QLEDGRTLADYNIQKESTLHLVLRLRG +Q+ V+T Sbjct: 49 QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT 83