BLASTX nr result
ID: Angelica22_contig00035520
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00035520 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002461653.1| hypothetical protein SORBIDRAFT_02g005970 [S... 59 5e-07 >ref|XP_002461653.1| hypothetical protein SORBIDRAFT_02g005970 [Sorghum bicolor] gi|241925030|gb|EER98174.1| hypothetical protein SORBIDRAFT_02g005970 [Sorghum bicolor] Length = 172 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = +3 Query: 150 NATLIVLIPKVDGP*AVGEFRRIPLCNVLYKCIFKILANRIKGV 281 N T+IV+IPKV+ P V +FR I LCNV+YK I K+LANR+KG+ Sbjct: 66 NDTMIVMIPKVENPDKVAQFRPISLCNVVYKVISKMLANRMKGI 109