BLASTX nr result
ID: Angelica22_contig00035418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00035418 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD96953.1| hypothetical protein [Cleome spinosa] 74 9e-12 emb|CAG28949.1| S-adenosylmethionine decarboxylase [Prunus persica] 74 2e-11 gb|ABR13282.1| putative S-adenosylmethionine decarboxylase [Prun... 74 2e-11 gb|AAC48988.1| putative [Catharanthus roseus] 72 4e-11 ref|XP_003516785.1| PREDICTED: S-adenosylmethionine decarboxylas... 72 4e-11 >gb|ABD96953.1| hypothetical protein [Cleome spinosa] Length = 78 Score = 74.3 bits (181), Expect = 9e-12 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 150 TLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNFARKPS 260 TLFYEAPLGYSIEDVRPHGGIKKFRSAAYSN A++PS Sbjct: 42 TLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCAKRPS 78 >emb|CAG28949.1| S-adenosylmethionine decarboxylase [Prunus persica] Length = 309 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 150 TLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNFARKPS 260 +LFYEAPLGYSIEDVRPHGGIKKFRSAAYSN RKPS Sbjct: 15 SLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVRKPS 51 >gb|ABR13282.1| putative S-adenosylmethionine decarboxylase [Prunus dulcis] Length = 56 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 150 TLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNFARKPS 260 +LFYEAPLGYSIEDVRPHGGIKKFRSAAYSN RKPS Sbjct: 20 SLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVRKPS 56 >gb|AAC48988.1| putative [Catharanthus roseus] Length = 51 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 150 TLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNFARKPS 260 +LFYEAPLGYSIEDVRP+GGIKKFRSAAYSN ARKPS Sbjct: 15 SLFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS 51 >ref|XP_003516785.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme-like [Glycine max] Length = 408 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/37 (91%), Positives = 36/37 (97%) Frame = +3 Query: 150 TLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNFARKPS 260 +LFYEAPLGYSIEDVRP+GGIKKFRSAAYSN ARKPS Sbjct: 17 SLFYEAPLGYSIEDVRPNGGIKKFRSAAYSNCARKPS 53