BLASTX nr result
ID: Angelica22_contig00035351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00035351 (559 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612524.1| Bystin [Medicago truncatula] gi|355513859|gb... 41 5e-06 ref|XP_003521441.1| PREDICTED: bystin-like [Glycine max] 41 8e-06 ref|XP_003524597.1| PREDICTED: bystin-like [Glycine max] 41 8e-06 >ref|XP_003612524.1| Bystin [Medicago truncatula] gi|355513859|gb|AES95482.1| Bystin [Medicago truncatula] Length = 495 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = +2 Query: 398 RDDILHDRRLHFELYQVVRSALYKAAAFY 484 RDDI ++RLHF LYQ ++ +LYK AAF+ Sbjct: 244 RDDIKKNQRLHFALYQTLKKSLYKPAAFF 272 Score = 34.7 bits (78), Expect(2) = 5e-06 Identities = 22/45 (48%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +1 Query: 259 EVVVYLDEPEMVS-NKMF*ATRIFNS*SGVEKE*RVHLPVLLPSI 390 E V+YL EP+ S N +F ATRIF S G +K R + VLLP + Sbjct: 199 EEVLYLTEPQKWSPNALFQATRIFASNFGAKKAERFYKLVLLPRV 243 >ref|XP_003521441.1| PREDICTED: bystin-like [Glycine max] Length = 442 Score = 40.8 bits (94), Expect(2) = 8e-06 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = +2 Query: 398 RDDILHDRRLHFELYQVVRSALYKAAAFY 484 R+DI ++RLHF LYQ ++ ALYK AAF+ Sbjct: 238 REDIRKNKRLHFALYQTLKKALYKPAAFF 266 Score = 33.9 bits (76), Expect(2) = 8e-06 Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +1 Query: 253 LREVVVYLDEPEMVS-NKMF*ATRIFNS*SGVEKE*RVHLPVLLPSI 390 L E V+Y+ EPE S N ++ ATRIF S G +K R + VLLP + Sbjct: 191 LWEEVLYITEPENWSPNALYQATRIFASNFGAKKAERFYKLVLLPRV 237 >ref|XP_003524597.1| PREDICTED: bystin-like [Glycine max] Length = 441 Score = 40.8 bits (94), Expect(2) = 8e-06 Identities = 17/29 (58%), Positives = 23/29 (79%) Frame = +2 Query: 398 RDDILHDRRLHFELYQVVRSALYKAAAFY 484 R+DI ++RLHF LYQ ++ ALYK AAF+ Sbjct: 237 REDIRKNKRLHFALYQTLKKALYKPAAFF 265 Score = 33.9 bits (76), Expect(2) = 8e-06 Identities = 22/47 (46%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +1 Query: 253 LREVVVYLDEPEMVS-NKMF*ATRIFNS*SGVEKE*RVHLPVLLPSI 390 L E V+Y+ EPE S N ++ ATRIF S G +K R + VLLP + Sbjct: 190 LWEEVLYITEPENWSPNALYQATRIFASNFGAKKAERFYKLVLLPRV 236