BLASTX nr result
ID: Angelica22_contig00034869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00034869 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB75788.1| putative protein [Arabidopsis thaliana] 49 8e-06 ref|NP_190161.2| Nucleotidyltransferase family protein [Arabidop... 49 8e-06 >emb|CAB75788.1| putative protein [Arabidopsis thaliana] Length = 690 Score = 49.3 bits (116), Expect(2) = 8e-06 Identities = 20/36 (55%), Positives = 29/36 (80%) Frame = -3 Query: 291 VEEFGSFVMDLFSCTSDLDLSVNFSNDAAEYPRDQK 184 +E +GSFVMD++S SDLD+S+NF N +E PR++K Sbjct: 89 LEAYGSFVMDMYSSQSDLDVSINFGNGTSEIPREKK 124 Score = 25.0 bits (53), Expect(2) = 8e-06 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 197 PATRKIKALRKFAKKFYSLQ 138 P +K++ L++FAKK SLQ Sbjct: 120 PREKKLEILKRFAKKLRSLQ 139 >ref|NP_190161.2| Nucleotidyltransferase family protein [Arabidopsis thaliana] gi|30793987|gb|AAP40443.1| unknown protein [Arabidopsis thaliana] gi|110739217|dbj|BAF01523.1| hypothetical protein [Arabidopsis thaliana] gi|332644545|gb|AEE78066.1| Nucleotidyltransferase family protein [Arabidopsis thaliana] Length = 682 Score = 49.3 bits (116), Expect(2) = 8e-06 Identities = 20/36 (55%), Positives = 29/36 (80%) Frame = -3 Query: 291 VEEFGSFVMDLFSCTSDLDLSVNFSNDAAEYPRDQK 184 +E +GSFVMD++S SDLD+S+NF N +E PR++K Sbjct: 89 LEAYGSFVMDMYSSQSDLDVSINFGNGTSEIPREKK 124 Score = 25.0 bits (53), Expect(2) = 8e-06 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 197 PATRKIKALRKFAKKFYSLQ 138 P +K++ L++FAKK SLQ Sbjct: 120 PREKKLEILKRFAKKLRSLQ 139