BLASTX nr result
ID: Angelica22_contig00034372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00034372 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136099.1| PREDICTED: pentatricopeptide repeat-containi... 110 4e-31 ref|XP_002512730.1| pentatricopeptide repeat-containing protein,... 110 5e-31 ref|XP_002887806.1| predicted protein [Arabidopsis lyrata subsp.... 111 1e-30 ref|XP_003542138.1| PREDICTED: pentatricopeptide repeat-containi... 108 6e-30 ref|NP_178203.1| pentatricopeptide repeat-containing protein [Ar... 107 1e-28 >ref|XP_004136099.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80880, mitochondrial-like [Cucumis sativus] gi|449509164|ref|XP_004163514.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80880, mitochondrial-like [Cucumis sativus] Length = 547 Score = 110 bits (276), Expect(2) = 4e-31 Identities = 52/87 (59%), Positives = 67/87 (77%) Frame = +2 Query: 2 SILLFKWGEKCKCNGGNNWSLIVWVLGSHKKFNIAWCLIRDMHRSLLDTRMAMLIMIDRY 181 S+L FKWGEK +L++WVLG+HKKF+ AW LIR++H SLL++ AML+MIDRY Sbjct: 132 SLLAFKWGEKVGAIDEEICNLMIWVLGNHKKFSTAWSLIRELHGSLLNSMQAMLVMIDRY 191 Query: 182 AAANEPVKAIEAFKLMEKFRMTPDKEA 262 A ANE KAI+ F +MEKFR+TPD+EA Sbjct: 192 AYANEASKAIKTFHMMEKFRLTPDQEA 218 Score = 48.9 bits (115), Expect(2) = 4e-31 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = +1 Query: 253 QGSTYTLLYYLCKNGNVEEAEEFMLLNKKLFPLEVE 360 Q + + LL LCK GN+EEAEEFM +NKKLFPL E Sbjct: 216 QEAFHVLLNSLCKYGNIEEAEEFMFVNKKLFPLGTE 251 >ref|XP_002512730.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547741|gb|EEF49233.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 552 Score = 110 bits (275), Expect(2) = 5e-31 Identities = 51/87 (58%), Positives = 65/87 (74%) Frame = +2 Query: 2 SILLFKWGEKCKCNGGNNWSLIVWVLGSHKKFNIAWCLIRDMHRSLLDTRMAMLIMIDRY 181 + L FKWGEK C + LIVW+LG+H+KFN AW +IRDMH+ ++ + MLIMIDRY Sbjct: 140 AFLGFKWGEKWGCIDEKSCELIVWILGNHRKFNNAWIVIRDMHQLSMNIQQTMLIMIDRY 199 Query: 182 AAANEPVKAIEAFKLMEKFRMTPDKEA 262 AAA+ P KAIE F +MEKF+M PD+EA Sbjct: 200 AAADNPGKAIEVFNIMEKFKMAPDEEA 226 Score = 48.9 bits (115), Expect(2) = 5e-31 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 265 YTLLYYLCKNGNVEEAEEFMLLNKKLFPLEVE 360 Y+L+ LC +G +EEAEEFM++NKKLFPLE E Sbjct: 228 YSLMNALCNHGYIEEAEEFMVVNKKLFPLETE 259 >ref|XP_002887806.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297333647|gb|EFH64065.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 541 Score = 111 bits (277), Expect(2) = 1e-30 Identities = 50/87 (57%), Positives = 64/87 (73%) Frame = +2 Query: 2 SILLFKWGEKCKCNGGNNWSLIVWVLGSHKKFNIAWCLIRDMHRSLLDTRMAMLIMIDRY 181 + L FKWGEK C+ L++WVLG+H+KFNIAWCLIRDM DTR AM +M+DRY Sbjct: 134 AFLAFKWGEKRGCDDQKACDLMIWVLGNHQKFNIAWCLIRDMFHVSKDTRKAMFLMMDRY 193 Query: 182 AAANEPVKAIEAFKLMEKFRMTPDKEA 262 AAAN+ ++AI F +M+KF+ TPD EA Sbjct: 194 AAANDTIQAIRTFDIMDKFKHTPDDEA 220 Score = 47.0 bits (110), Expect(2) = 1e-30 Identities = 19/30 (63%), Positives = 28/30 (93%) Frame = +1 Query: 271 LLYYLCKNGNVEEAEEFMLLNKKLFPLEVE 360 LLY LC++G++E+A+EFML +KKLFP++VE Sbjct: 224 LLYALCRHGHIEKAQEFMLASKKLFPVDVE 253 >ref|XP_003542138.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80880, mitochondrial-like [Glycine max] Length = 504 Score = 108 bits (269), Expect(2) = 6e-30 Identities = 51/87 (58%), Positives = 64/87 (73%) Frame = +2 Query: 2 SILLFKWGEKCKCNGGNNWSLIVWVLGSHKKFNIAWCLIRDMHRSLLDTRMAMLIMIDRY 181 ++L FKW C N +L++WVL +H KF+ AWC+IRDMHRS L TR AMLIMIDRY Sbjct: 107 ALLAFKWN--CHGNDEKVCNLMIWVLTTHGKFSTAWCIIRDMHRSSLSTRQAMLIMIDRY 164 Query: 182 AAANEPVKAIEAFKLMEKFRMTPDKEA 262 A+AN KAI+ F M+KFR+TPD+EA Sbjct: 165 ASANNSAKAIQTFNFMDKFRLTPDQEA 191 Score = 47.8 bits (112), Expect(2) = 6e-30 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +1 Query: 253 QGSTYTLLYYLCKNGNVEEAEEFMLLNKKLFPLEVE 360 Q + + LL L K GNVEEAEEFML+NKKLFPL E Sbjct: 189 QEAFHALLTALSKYGNVEEAEEFMLVNKKLFPLNTE 224 >ref|NP_178203.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200729|sp|Q9SAH2.1|PP137_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g80880, mitochondrial; Flags: Precursor gi|6503300|gb|AAF14676.1|AC011713_24 Contains PF|01535 Domain of unknown function [Arabidopsis thaliana] gi|91806121|gb|ABE65789.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332198342|gb|AEE36463.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 540 Score = 107 bits (266), Expect(2) = 1e-28 Identities = 49/87 (56%), Positives = 63/87 (72%) Frame = +2 Query: 2 SILLFKWGEKCKCNGGNNWSLIVWVLGSHKKFNIAWCLIRDMHRSLLDTRMAMLIMIDRY 181 + L FKWGEK C+ + L++WVLG+H+KFNIAWCLIRDM DTR AM +M+DRY Sbjct: 140 AFLAFKWGEKRGCDDQKSCDLMIWVLGNHQKFNIAWCLIRDMFNVSKDTRKAMFLMMDRY 199 Query: 182 AAANEPVKAIEAFKLMEKFRMTPDKEA 262 AAAN+ +AI F +M+KF+ TP EA Sbjct: 200 AAANDTSQAIRTFDIMDKFKHTPYDEA 226 Score = 44.7 bits (104), Expect(2) = 1e-28 Identities = 19/30 (63%), Positives = 27/30 (90%) Frame = +1 Query: 271 LLYYLCKNGNVEEAEEFMLLNKKLFPLEVE 360 LL LC++G++E+AEEFML +KKLFP++VE Sbjct: 230 LLCALCRHGHIEKAEEFMLASKKLFPVDVE 259