BLASTX nr result
ID: Angelica22_contig00034324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00034324 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK35478.1| unknown [Medicago truncatula] 52 8e-13 ref|XP_003600196.1| Annotation was added to scaffolds in Novembe... 52 8e-13 ref|XP_002529023.1| acyltransferase, putative [Ricinus communis]... 51 2e-11 emb|CBI26714.3| unnamed protein product [Vitis vinifera] 50 8e-11 ref|XP_003553042.1| PREDICTED: LOW QUALITY PROTEIN: probable lon... 46 2e-08 >gb|AFK35478.1| unknown [Medicago truncatula] Length = 344 Score = 52.0 bits (123), Expect(2) = 8e-13 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 120 ELILAITGFPVRAILGLEI*PQFNEPYLATSLQD 19 EL+LAI+ PVR + G EI PQFNEPYL+TSLQD Sbjct: 161 ELVLAISAAPVRTMFGFEIEPQFNEPYLSTSLQD 194 Score = 46.2 bits (108), Expect(2) = 8e-13 Identities = 21/34 (61%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = -3 Query: 221 KVLLLVMII--YAYKLDLHPYVILCLYCCHVYLG 126 KV++LV II Y Y+ +HPY IL LYCCH+YLG Sbjct: 126 KVVILVAIICSYEYREYMHPYFILVLYCCHMYLG 159 >ref|XP_003600196.1| Annotation was added to scaffolds in November 2011~Long-chain-alcohol O-fatty-acyltransferase [Medicago truncatula] gi|355489244|gb|AES70447.1| Annotation was added to scaffolds in November 2011~Long-chain-alcohol O-fatty-acyltransferase [Medicago truncatula] Length = 344 Score = 52.0 bits (123), Expect(2) = 8e-13 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -2 Query: 120 ELILAITGFPVRAILGLEI*PQFNEPYLATSLQD 19 EL+LAI+ PVR + G EI PQFNEPYL+TSLQD Sbjct: 161 ELVLAISAAPVRTMFGFEIEPQFNEPYLSTSLQD 194 Score = 46.2 bits (108), Expect(2) = 8e-13 Identities = 21/34 (61%), Positives = 26/34 (76%), Gaps = 2/34 (5%) Frame = -3 Query: 221 KVLLLVMII--YAYKLDLHPYVILCLYCCHVYLG 126 KV++LV II Y Y+ +HPY IL LYCCH+YLG Sbjct: 126 KVVILVAIICSYEYREYMHPYFILVLYCCHMYLG 159 >ref|XP_002529023.1| acyltransferase, putative [Ricinus communis] gi|223531503|gb|EEF33334.1| acyltransferase, putative [Ricinus communis] Length = 359 Score = 50.8 bits (120), Expect(2) = 2e-11 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = -2 Query: 120 ELILAITGFPVRAILGLEI*PQFNEPYLATSLQD 19 E+ILAI+ P R + G E+ PQFNEPYLATSLQD Sbjct: 171 EIILAISATPARVLFGFELEPQFNEPYLATSLQD 204 Score = 42.4 bits (98), Expect(2) = 2e-11 Identities = 19/33 (57%), Positives = 25/33 (75%), Gaps = 2/33 (6%) Frame = -3 Query: 221 KVLLLVMII--YAYKLDLHPYVILCLYCCHVYL 129 KVLL+ ++ Y+YK LHPY+IL LYC H+YL Sbjct: 136 KVLLVALLFHCYSYKQFLHPYLILALYCLHMYL 168 >emb|CBI26714.3| unnamed protein product [Vitis vinifera] Length = 611 Score = 49.7 bits (117), Expect(2) = 8e-11 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 120 ELILAITGFPVRAILGLEI*PQFNEPYLATSLQD 19 ELILA+ P RAI GLE+ PQFNEPYLATSLQD Sbjct: 159 ELILALAAAPARAI-GLELEPQFNEPYLATSLQD 191 Score = 41.6 bits (96), Expect(2) = 8e-11 Identities = 17/29 (58%), Positives = 21/29 (72%) Frame = -3 Query: 215 LLLVMIIYAYKLDLHPYVILCLYCCHVYL 129 L ++ +Y Y+ LHP VIL LYCCHVYL Sbjct: 128 LAALLKVYKYRQFLHPNVILALYCCHVYL 156 >ref|XP_003553042.1| PREDICTED: LOW QUALITY PROTEIN: probable long-chain-alcohol O-fatty-acyltransferase 1-like [Glycine max] Length = 371 Score = 45.8 bits (107), Expect(2) = 2e-08 Identities = 20/34 (58%), Positives = 26/34 (76%) Frame = -2 Query: 120 ELILAITGFPVRAILGLEI*PQFNEPYLATSLQD 19 EL+ A+ PV+ + GLEI P FNEPYL++SLQD Sbjct: 192 ELVFALIATPVQTLFGLEIEPHFNEPYLSSSLQD 225 Score = 37.4 bits (85), Expect(2) = 2e-08 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = -3 Query: 221 KVLLLVMI--IYAYKLDLHPYVILCLYCCHVYLG 126 K+L+ MI +Y Y HP+ IL LYC H+YLG Sbjct: 157 KLLIFAMIARVYEYNEYFHPHFILFLYCLHLYLG 190