BLASTX nr result
ID: Angelica22_contig00034291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00034291 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324622.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 dbj|BAJ33817.1| unnamed protein product [Thellungiella halophila] 61 8e-08 ref|XP_002531943.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|NP_197527.1| heptahelical transmembrane protein1 [Arabidopsi... 61 1e-07 ref|XP_002331026.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 >ref|XP_002324622.1| predicted protein [Populus trichocarpa] gi|222866056|gb|EEF03187.1| predicted protein [Populus trichocarpa] Length = 345 Score = 62.8 bits (151), Expect = 3e-08 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = +1 Query: 1 HSHQIFHVFVIMGALSHYGAALVFLDFRSKIGCETDM 111 HSHQIFHVFV++GAL+HYGA L+FL++R +GCE ++ Sbjct: 309 HSHQIFHVFVVLGALAHYGATLLFLEYRDLVGCEVNL 345 >dbj|BAJ33817.1| unnamed protein product [Thellungiella halophila] Length = 331 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 1 HSHQIFHVFVIMGALSHYGAALVFLDFRSKIGC 99 HSHQIFHVFV++GALSHY AAL+FLD+R +GC Sbjct: 299 HSHQIFHVFVVLGALSHYAAALLFLDWRDHVGC 331 >ref|XP_002531943.1| conserved hypothetical protein [Ricinus communis] gi|223528389|gb|EEF30425.1| conserved hypothetical protein [Ricinus communis] Length = 359 Score = 60.8 bits (146), Expect = 1e-07 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = +1 Query: 1 HSHQIFHVFVIMGALSHYGAALVFLDFRSKIGC 99 HSHQIFHVFV++GAL+HYGA +VFL++R ++GC Sbjct: 327 HSHQIFHVFVVLGALAHYGAIVVFLEYRDRVGC 359 >ref|NP_197527.1| heptahelical transmembrane protein1 [Arabidopsis thaliana] gi|15982834|gb|AAL09764.1| AT5g20270/F5O24_160 [Arabidopsis thaliana] gi|21592494|gb|AAM64444.1| unknown [Arabidopsis thaliana] gi|23506109|gb|AAN28914.1| At5g20270/F5O24_160 [Arabidopsis thaliana] gi|110741984|dbj|BAE98931.1| hypothetical protein [Arabidopsis thaliana] gi|332005440|gb|AED92823.1| heptahelical transmembrane protein1 [Arabidopsis thaliana] Length = 332 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 1 HSHQIFHVFVIMGALSHYGAALVFLDFRSKIGC 99 HSHQIFHVFV++GALSHY AAL+FLD+R +GC Sbjct: 300 HSHQIFHVFVLLGALSHYAAALLFLDWRDHVGC 332 >ref|XP_002331026.1| predicted protein [Populus trichocarpa] gi|222872956|gb|EEF10087.1| predicted protein [Populus trichocarpa] Length = 322 Score = 60.5 bits (145), Expect = 1e-07 Identities = 23/37 (62%), Positives = 32/37 (86%) Frame = +1 Query: 1 HSHQIFHVFVIMGALSHYGAALVFLDFRSKIGCETDM 111 HSHQ+FHVFV++GAL+HYGA L FL++RS +GC ++ Sbjct: 282 HSHQVFHVFVVLGALAHYGATLSFLEYRSHVGCGVNL 318