BLASTX nr result
ID: Angelica22_contig00033687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00033687 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234779.1| MAP3K epsilon protein kinase [Solanum lycope... 58 9e-07 >ref|NP_001234779.1| MAP3K epsilon protein kinase [Solanum lycopersicum] gi|300827400|gb|ADK36642.1| MAPKKKe [Solanum lycopersicum] Length = 1401 Score = 57.8 bits (138), Expect = 9e-07 Identities = 37/109 (33%), Positives = 54/109 (49%) Frame = +2 Query: 32 QDSQTDLLSREANAEIEDSIEDSSAKRDLVEKRAASHEDEMLSDQVSTSTLQEKLPIKSN 211 ++S T L S E E S E A +E R ED+ +SD V T + EK PI++N Sbjct: 322 KESSTTLASPEV-LETSKSEEVDGASSIRIEGRTDKIEDQFMSDPVPTLAIHEKSPIQNN 380 Query: 212 PNSEVATVSAELQEPSQSHNQEKLPISGELGSPNSRKKHPVARKAEEKG 358 + + LQ + +K+ +GEL S SR ++ V RK E+KG Sbjct: 381 TDGLAVNKESALQSSTDLSEPDKVFANGELESSESRGRNTVGRKVEDKG 429