BLASTX nr result
ID: Angelica22_contig00032644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00032644 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307796.1| bromodomain protein [Populus trichocarpa] gi... 55 8e-06 >ref|XP_002307796.1| bromodomain protein [Populus trichocarpa] gi|222857245|gb|EEE94792.1| bromodomain protein [Populus trichocarpa] Length = 617 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +3 Query: 108 ASIFRADMKYGKRLVLIDETRRDTYKQFHPSTFSHEPSSLSDLDGDTKQLM 260 AS+ +A +KYGK+ +++DE +RDTYK HP SHEPS L DG+ KQLM Sbjct: 355 ASVVKAVIKYGKKPIVLDENKRDTYK--HPLD-SHEPSVLMTFDGELKQLM 402