BLASTX nr result
ID: Angelica22_contig00032550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00032550 (219 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptas... 57 1e-06 >gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 1297 Score = 57.4 bits (137), Expect = 1e-06 Identities = 33/72 (45%), Positives = 45/72 (62%), Gaps = 2/72 (2%) Frame = +2 Query: 8 YRLQLPEGSRVHSVFHVS*LKRAIGHHL*AGHLPTVE--LPATAEPQFVLEYRELVHDEQ 181 Y+L+LPEGSRVHSVFHVS LK+A+G++ +LP +E EP+ VL R + + Sbjct: 1162 YKLKLPEGSRVHSVFHVSLLKKAVGNYHEEENLPDLEEDKGVVIEPETVLTRRTIQVQGE 1221 Query: 182 STPQVLIQ*KGQ 217 QVL+ GQ Sbjct: 1222 KIDQVLVHWMGQ 1233