BLASTX nr result
ID: Angelica22_contig00032504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00032504 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEE25655.1| auxin-responsive protein [Gossypium hirsutum] 61 1e-07 ref|XP_002308067.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 ref|XP_002324639.1| predicted protein [Populus trichocarpa] gi|2... 55 4e-06 ref|XP_004167111.1| PREDICTED: auxin-responsive protein IAA8-lik... 54 1e-05 ref|XP_004136353.1| PREDICTED: auxin-responsive protein IAA29-li... 54 1e-05 >gb|AEE25655.1| auxin-responsive protein [Gossypium hirsutum] Length = 255 Score = 60.8 bits (146), Expect = 1e-07 Identities = 23/35 (65%), Positives = 32/35 (91%) Frame = -1 Query: 309 YKLVYQDEEGDWLLAEDLPWKSFMRSVQCLKWVKS 205 +KL YQD EGDWLLAED+PW++F+RS++CLK ++S Sbjct: 219 FKLTYQDREGDWLLAEDVPWRTFIRSLKCLKLIRS 253 >ref|XP_002308067.1| predicted protein [Populus trichocarpa] gi|222854043|gb|EEE91590.1| predicted protein [Populus trichocarpa] Length = 233 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = -1 Query: 309 YKLVYQDEEGDWLLAEDLPWKSFMRSVQCLKWVKSSH 199 Y+L YQD EGDWLLAED+PW++F+ SVQ LK ++SS+ Sbjct: 197 YRLTYQDREGDWLLAEDVPWRNFLGSVQRLKLMRSSN 233 >ref|XP_002324639.1| predicted protein [Populus trichocarpa] gi|222866073|gb|EEF03204.1| predicted protein [Populus trichocarpa] Length = 233 Score = 55.5 bits (132), Expect = 4e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = -1 Query: 309 YKLVYQDEEGDWLLAEDLPWKSFMRSVQCLKWVKSS 202 Y+L YQD EGDWLLAED+PW++F+ +VQ LK ++ S Sbjct: 197 YRLTYQDREGDWLLAEDVPWRNFLGTVQLLKLMRRS 232 >ref|XP_004167111.1| PREDICTED: auxin-responsive protein IAA8-like [Cucumis sativus] Length = 234 Score = 54.3 bits (129), Expect = 1e-05 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = -1 Query: 303 LVYQDEEGDWLLAEDLPWKSFMRSVQCLKWVK 208 L YQD+EGDWLLA DLPW++F+ SVQC+K ++ Sbjct: 198 LTYQDKEGDWLLAGDLPWQNFVESVQCMKIIR 229 >ref|XP_004136353.1| PREDICTED: auxin-responsive protein IAA29-like [Cucumis sativus] Length = 234 Score = 54.3 bits (129), Expect = 1e-05 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = -1 Query: 303 LVYQDEEGDWLLAEDLPWKSFMRSVQCLKWVK 208 L YQD+EGDWLLA DLPW++F+ SVQC+K ++ Sbjct: 198 LTYQDKEGDWLLAGDLPWQNFVESVQCMKIIR 229