BLASTX nr result
ID: Angelica22_contig00032419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00032419 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002887440.1| predicted protein [Arabidopsis lyrata subsp.... 59 3e-07 ref|XP_003528505.1| PREDICTED: uncharacterized protein LOC100802... 59 4e-07 ref|NP_177404.1| hydroxyproline-rich glycoprotein family protein... 55 6e-06 >ref|XP_002887440.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297333281|gb|EFH63699.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 126 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = +2 Query: 128 RKNKTRVPHQHKTPPPSEEKLNLGKKIGLLFMGLVAILQVCVVAFLVIKSRQM 286 R+ K R HK PPP ++KLN+GK +GL F + A LQV V AFL+ K RQ+ Sbjct: 66 RRKKWRQRRHHKHPPPPQQKLNMGKTVGLFFAAVAAALQVVVAAFLLFKRRQL 118 >ref|XP_003528505.1| PREDICTED: uncharacterized protein LOC100802107 [Glycine max] Length = 161 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 8/59 (13%) Frame = +2 Query: 134 NKTRVPHQHKT--------PPPSEEKLNLGKKIGLLFMGLVAILQVCVVAFLVIKSRQM 286 N R PH+ + PPP K+N GKK+GLLF+G+ AI+QV VV FLVIK RQ+ Sbjct: 92 NVRRPPHRRRRHRRPPPPPPPPPPHKMNAGKKVGLLFVGIAAIMQVGVVGFLVIKRRQL 150 >ref|NP_177404.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis thaliana] gi|334183868|ref|NP_001185384.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis thaliana] gi|12323771|gb|AAG51851.1|AC010926_14 hypothetical protein; 72245-71838 [Arabidopsis thaliana] gi|38454042|gb|AAR20715.1| At1g72600 [Arabidopsis thaliana] gi|45592904|gb|AAS68106.1| At1g72600 [Arabidopsis thaliana] gi|332197225|gb|AEE35346.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis thaliana] gi|332197226|gb|AEE35347.1| hydroxyproline-rich glycoprotein family protein [Arabidopsis thaliana] Length = 135 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/56 (48%), Positives = 35/56 (62%), Gaps = 3/56 (5%) Frame = +2 Query: 128 RKNKTRVPHQHK---TPPPSEEKLNLGKKIGLLFMGLVAILQVCVVAFLVIKSRQM 286 R+ K R HK PPP ++K+N GK +GL F G+ A LQV V AFL+ K RQ+ Sbjct: 72 RRKKWRQRRHHKHPPPPPPKKQKVNTGKTVGLFFAGVAAALQVVVAAFLIFKRRQL 127