BLASTX nr result
ID: Angelica22_contig00032112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00032112 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003611921.1| hypothetical protein MTR_5g019430 [Medicago ... 66 3e-09 ref|XP_002525095.1| AT14A, putative [Ricinus communis] gi|223535... 64 2e-08 ref|XP_002525093.1| AT14A, putative [Ricinus communis] gi|223535... 64 2e-08 ref|XP_003558574.1| PREDICTED: UPF0496 protein 1-like isoform 1 ... 63 3e-08 ref|XP_002306083.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 >ref|XP_003611921.1| hypothetical protein MTR_5g019430 [Medicago truncatula] gi|355513256|gb|AES94879.1| hypothetical protein MTR_5g019430 [Medicago truncatula] Length = 380 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/54 (57%), Positives = 42/54 (77%) Frame = +2 Query: 257 YEAACRLDPELRSFDSTVHHRTTTLLNSLSGSFDVRLVSLDSLGEVTKSLLEMD 418 YEAAC DP L+SFD+T+ RT ++NSL+ +VR +SL+SLGEVT SLL+M+ Sbjct: 34 YEAACVNDPNLQSFDATIQERTNRVINSLAQGIEVRSISLESLGEVTGSLLDMN 87 >ref|XP_002525095.1| AT14A, putative [Ricinus communis] gi|223535554|gb|EEF37222.1| AT14A, putative [Ricinus communis] Length = 390 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = +2 Query: 257 YEAACRLDPELRSFDSTVHHRTTTLLNSLSGSFDVRLVSLDSLGEVTKSLLEMD 418 YE AC LDP+L++FD+T+H RT +LNSLS +VR +S +SL EVT LL+M+ Sbjct: 40 YEDACMLDPDLQAFDTTLHERTNRVLNSLSTGVEVRSLSFNSLKEVTNCLLDMN 93 >ref|XP_002525093.1| AT14A, putative [Ricinus communis] gi|223535552|gb|EEF37220.1| AT14A, putative [Ricinus communis] Length = 348 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = +2 Query: 257 YEAACRLDPELRSFDSTVHHRTTTLLNSLSGSFDVRLVSLDSLGEVTKSLLEMD 418 YE AC LDP+L++FD+T+H RT +LNSLS +VR +S +SL EVT LL+M+ Sbjct: 40 YEDACMLDPDLQAFDTTLHERTNRVLNSLSTGVEVRSLSFNSLKEVTNCLLDMN 93 >ref|XP_003558574.1| PREDICTED: UPF0496 protein 1-like isoform 1 [Brachypodium distachyon] gi|357113569|ref|XP_003558575.1| PREDICTED: UPF0496 protein 1-like isoform 2 [Brachypodium distachyon] Length = 393 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/54 (55%), Positives = 42/54 (77%) Frame = +2 Query: 257 YEAACRLDPELRSFDSTVHHRTTTLLNSLSGSFDVRLVSLDSLGEVTKSLLEMD 418 YEAACR DPE+R+FDST+ RT+ +++L+ +VR +SLDSL EVT LL+M+ Sbjct: 37 YEAACRYDPEVRTFDSTLQRRTSRAISTLAVGVEVRSMSLDSLREVTGCLLDMN 90 >ref|XP_002306083.1| predicted protein [Populus trichocarpa] gi|222849047|gb|EEE86594.1| predicted protein [Populus trichocarpa] Length = 363 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/54 (55%), Positives = 42/54 (77%) Frame = +2 Query: 257 YEAACRLDPELRSFDSTVHHRTTTLLNSLSGSFDVRLVSLDSLGEVTKSLLEMD 418 YEAACRLD +L+SFD+T+ RT ++N+L+ +VR +S DSL EVT+ LLEM+ Sbjct: 32 YEAACRLDKDLQSFDTTLQARTNHVINTLAVGIEVRALSFDSLKEVTECLLEMN 85