BLASTX nr result
ID: Angelica22_contig00031871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00031871 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus c... 158 3e-41 >ref|YP_006291838.1| orf49 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081995|gb|AEY81187.1| orf49 (mitochondrion) [Daucus carota subsp. sativus] Length = 161 Score = 158 bits (399), Expect(2) = 3e-41 Identities = 74/82 (90%), Positives = 77/82 (93%) Frame = -1 Query: 284 MDPIPYIERSFLSIDRKIFVKYRTFPFFNNSSYPRQLITSTPPHTTSWGGCSPFESNKVS 105 MDPIPYIE SFLSIDRKIFVKYRTFPFF NSSYPRQLITSTPPHTTSWGGCSPFESNKVS Sbjct: 1 MDPIPYIEHSFLSIDRKIFVKYRTFPFFKNSSYPRQLITSTPPHTTSWGGCSPFESNKVS 60 Query: 104 SRGFIATFILKESEEQTFLLVK 39 SRGFIATF+LKESEE TF ++ Sbjct: 61 SRGFIATFVLKESEEPTFSQIR 82 Score = 35.4 bits (80), Expect(2) = 3e-41 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = -3 Query: 51 SFSKIRALLPSLRPHHL 1 +FS+IRALLPSLRPHHL Sbjct: 77 TFSQIRALLPSLRPHHL 93