BLASTX nr result
ID: Angelica22_contig00031858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00031858 (566 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263508.2| PREDICTED: uncharacterized protein LOC100240... 77 1e-12 emb|CBI29366.3| unnamed protein product [Vitis vinifera] 77 1e-12 ref|XP_002527086.1| conserved hypothetical protein [Ricinus comm... 69 7e-10 ref|XP_002302157.1| predicted protein [Populus trichocarpa] gi|2... 66 4e-09 ref|XP_004140950.1| PREDICTED: 30S ribosomal protein S1 homolog ... 62 6e-08 >ref|XP_002263508.2| PREDICTED: uncharacterized protein LOC100240915 [Vitis vinifera] Length = 513 Score = 77.4 bits (189), Expect = 1e-12 Identities = 32/57 (56%), Positives = 41/57 (71%) Frame = +3 Query: 3 RVYSEAEEMAKKYRQKMPTASLARKPEQFPADTLSYEDEEDLYSNWKWFNFEMDNEP 173 +V+S+AEEMAKKYRQK+P + RK E P D L + DE LY+NW+WF FE D+ P Sbjct: 456 KVFSDAEEMAKKYRQKLPAVTATRKLEPLPTDALPFHDEASLYANWRWFKFERDDGP 512 >emb|CBI29366.3| unnamed protein product [Vitis vinifera] Length = 435 Score = 77.4 bits (189), Expect = 1e-12 Identities = 32/57 (56%), Positives = 41/57 (71%) Frame = +3 Query: 3 RVYSEAEEMAKKYRQKMPTASLARKPEQFPADTLSYEDEEDLYSNWKWFNFEMDNEP 173 +V+S+AEEMAKKYRQK+P + RK E P D L + DE LY+NW+WF FE D+ P Sbjct: 378 KVFSDAEEMAKKYRQKLPAVTATRKLEPLPTDALPFHDEASLYANWRWFKFERDDGP 434 >ref|XP_002527086.1| conserved hypothetical protein [Ricinus communis] gi|223533509|gb|EEF35249.1| conserved hypothetical protein [Ricinus communis] Length = 476 Score = 68.6 bits (166), Expect = 7e-10 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = +3 Query: 3 RVYSEAEEMAKKYRQKMPTASLARKPEQFPADTLSYEDEEDLYSNWKWFNFEMD 164 +V++EAEEMAKKYRQK+P RK + TL+++DE +Y+NWKWF FE D Sbjct: 423 KVFAEAEEMAKKYRQKLPAVLATRKSATPLSSTLTFDDEATMYANWKWFKFERD 476 >ref|XP_002302157.1| predicted protein [Populus trichocarpa] gi|222843883|gb|EEE81430.1| predicted protein [Populus trichocarpa] Length = 486 Score = 65.9 bits (159), Expect = 4e-09 Identities = 31/55 (56%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +3 Query: 3 RVYSEAEEMAKKYRQKMPTASLARKPEQFPA-DTLSYEDEEDLYSNWKWFNFEMD 164 +V++EAEEMAKKYRQK+P +S KPE P+ + LS + E LY+NWKWF FE + Sbjct: 432 KVFAEAEEMAKKYRQKLPASSTNLKPEIPPSKNALSSDTEATLYANWKWFKFEKE 486 >ref|XP_004140950.1| PREDICTED: 30S ribosomal protein S1 homolog A-like [Cucumis sativus] Length = 530 Score = 62.0 bits (149), Expect = 6e-08 Identities = 25/52 (48%), Positives = 37/52 (71%) Frame = +3 Query: 3 RVYSEAEEMAKKYRQKMPTASLARKPEQFPADTLSYEDEEDLYSNWKWFNFE 158 +V+SEA+ MAKKYRQ++P+ +P+ P L +E+E +Y+NWKWF FE Sbjct: 478 KVFSEAKIMAKKYRQRLPSLDGILRPKTAPTTDLPFENESSMYANWKWFKFE 529