BLASTX nr result
ID: Angelica22_contig00031816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00031816 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73490.1| hypothetical protein VITISV_040575 [Vitis vinifera] 132 3e-29 ref|XP_002282768.1| PREDICTED: probable inactive leucine-rich re... 131 5e-29 ref|XP_002311473.1| predicted protein [Populus trichocarpa] gi|2... 125 4e-27 ref|XP_002526283.1| ATP binding protein, putative [Ricinus commu... 125 5e-27 ref|XP_002315920.1| predicted protein [Populus trichocarpa] gi|2... 124 6e-27 >emb|CAN73490.1| hypothetical protein VITISV_040575 [Vitis vinifera] Length = 713 Score = 132 bits (332), Expect = 3e-29 Identities = 61/76 (80%), Positives = 70/76 (92%) Frame = -3 Query: 229 RTLVLSQNNFSGGLPDGFGISLVSLEKLDISINRFSGPVPSDLGNLSNLQGTADLSHNLF 50 +TL LSQNNF+G LPDGFG L+SLEKLD+S N+FSGP+PSD+GNLSNLQGT DLSHN+F Sbjct: 163 KTLXLSQNNFTGSLPDGFGKGLISLEKLDLSFNKFSGPIPSDIGNLSNLQGTVDLSHNIF 222 Query: 49 SGSIPASLGNLPEKVY 2 SGSIPASLG+LPEKVY Sbjct: 223 SGSIPASLGDLPEKVY 238 >ref|XP_002282768.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 [Vitis vinifera] gi|297737773|emb|CBI26974.3| unnamed protein product [Vitis vinifera] Length = 713 Score = 131 bits (330), Expect = 5e-29 Identities = 61/76 (80%), Positives = 70/76 (92%) Frame = -3 Query: 229 RTLVLSQNNFSGGLPDGFGISLVSLEKLDISINRFSGPVPSDLGNLSNLQGTADLSHNLF 50 +TL LSQNNF+G LPDGFG L+SLEKLD+S N+FSGP+PSD+GNLSNLQGT DLSHN+F Sbjct: 163 KTLDLSQNNFTGSLPDGFGKGLISLEKLDLSFNKFSGPIPSDIGNLSNLQGTVDLSHNIF 222 Query: 49 SGSIPASLGNLPEKVY 2 SGSIPASLG+LPEKVY Sbjct: 223 SGSIPASLGDLPEKVY 238 >ref|XP_002311473.1| predicted protein [Populus trichocarpa] gi|222851293|gb|EEE88840.1| predicted protein [Populus trichocarpa] Length = 717 Score = 125 bits (314), Expect = 4e-27 Identities = 60/76 (78%), Positives = 68/76 (89%) Frame = -3 Query: 229 RTLVLSQNNFSGGLPDGFGISLVSLEKLDISINRFSGPVPSDLGNLSNLQGTADLSHNLF 50 R L LSQNNF+G LP GFG LVSLEKLD+S N+F+G +PSD+GNLS+LQGTADLSHNLF Sbjct: 163 RVLDLSQNNFTGSLPVGFGTGLVSLEKLDLSFNKFNGSIPSDMGNLSSLQGTADLSHNLF 222 Query: 49 SGSIPASLGNLPEKVY 2 +GSIPASLGNLPEKVY Sbjct: 223 TGSIPASLGNLPEKVY 238 >ref|XP_002526283.1| ATP binding protein, putative [Ricinus communis] gi|223534364|gb|EEF36072.1| ATP binding protein, putative [Ricinus communis] Length = 715 Score = 125 bits (313), Expect = 5e-27 Identities = 60/76 (78%), Positives = 66/76 (86%) Frame = -3 Query: 229 RTLVLSQNNFSGGLPDGFGISLVSLEKLDISINRFSGPVPSDLGNLSNLQGTADLSHNLF 50 R L LSQNNFSG LPDGFG VSLEKLD+S N+F+G +PSD+GNLS+LQGT DLSHN F Sbjct: 162 RALDLSQNNFSGSLPDGFGSGFVSLEKLDLSFNKFNGSIPSDMGNLSSLQGTVDLSHNHF 221 Query: 49 SGSIPASLGNLPEKVY 2 SGSIPASLGNLPEKVY Sbjct: 222 SGSIPASLGNLPEKVY 237 >ref|XP_002315920.1| predicted protein [Populus trichocarpa] gi|222864960|gb|EEF02091.1| predicted protein [Populus trichocarpa] Length = 716 Score = 124 bits (312), Expect = 6e-27 Identities = 60/76 (78%), Positives = 68/76 (89%) Frame = -3 Query: 229 RTLVLSQNNFSGGLPDGFGISLVSLEKLDISINRFSGPVPSDLGNLSNLQGTADLSHNLF 50 R L LSQNN +G LP GFG SLVSLEKLD+S N+F+G +PSD+GNLS+LQGTADLSHNLF Sbjct: 163 RALDLSQNNLTGSLPVGFGASLVSLEKLDLSFNKFNGSIPSDMGNLSSLQGTADLSHNLF 222 Query: 49 SGSIPASLGNLPEKVY 2 +GSIPASLGNLPEKVY Sbjct: 223 TGSIPASLGNLPEKVY 238