BLASTX nr result
ID: Angelica22_contig00031694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00031694 (602 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593067.1| FBD-associated F-box protein [Medicago trunc... 59 9e-07 >ref|XP_003593067.1| FBD-associated F-box protein [Medicago truncatula] gi|355482115|gb|AES63318.1| FBD-associated F-box protein [Medicago truncatula] Length = 466 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = +1 Query: 451 KKKKSVRICEDKVDRISELPDDLIHRILSFVEAGETVKTSVIFKRWKNIW 600 +++ + E KVD+IS LPD+++ RILSFV E V TSV+ KRW N+W Sbjct: 3 RRRPIISTSESKVDKISSLPDEILFRILSFVSTKEAVATSVLSKRWTNLW 52 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/75 (40%), Positives = 43/75 (57%) Frame = -1 Query: 332 KNKKSVRICEDKVDRISQLPDDPIHRILSFIEAGEAVQTSVISK**NDIWTTLLFVDFDW 153 + + + E KVD+IS LPD+ + RILSF+ EAV TSV+SK ++W Sbjct: 3 RRRPIISTSESKVDKISSLPDEILFRILSFVSTKEAVATSVLSKRWTNLW---------- 52 Query: 152 YAHNLPNINFKYVRI 108 H LPNI+F +R+ Sbjct: 53 --HYLPNIDFTDIRV 65