BLASTX nr result
ID: Angelica22_contig00031625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00031625 (532 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004168692.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 ref|XP_004142091.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 ref|XP_003549029.1| PREDICTED: pentatricopeptide repeat-containi... 62 7e-08 ref|XP_002310520.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 ref|XP_002274656.2| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 >ref|XP_004168692.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42450, mitochondrial-like [Cucumis sativus] Length = 516 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = -1 Query: 532 KGLQRVPGCSWIEIQSNIHVFVTRDEKHDQSNEIYMLLWIFLKHATDSQN 383 KGL+R+PGCSWIEI+S +HVFVT D+ H Q +EIY L F++H + ++ Sbjct: 460 KGLKRIPGCSWIEIRSKVHVFVTGDKNHHQKDEIYSALKFFVEHLKERED 509 >ref|XP_004142091.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42450, mitochondrial-like [Cucumis sativus] Length = 516 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = -1 Query: 532 KGLQRVPGCSWIEIQSNIHVFVTRDEKHDQSNEIYMLLWIFLKHATDSQN 383 KGL+R+PGCSWIEI+S +HVFVT D+ H Q +EIY L F++H + ++ Sbjct: 460 KGLKRIPGCSWIEIRSKVHVFVTGDKNHHQKDEIYSALKFFVEHLKERED 509 >ref|XP_003549029.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42450, mitochondrial-like [Glycine max] Length = 506 Score = 61.6 bits (148), Expect = 7e-08 Identities = 22/50 (44%), Positives = 38/50 (76%) Frame = -1 Query: 532 KGLQRVPGCSWIEIQSNIHVFVTRDEKHDQSNEIYMLLWIFLKHATDSQN 383 KG++R+PG SWIE++ +H F+T D+ HD+ +EIY+LL F +H ++++ Sbjct: 445 KGMKRIPGSSWIEVRGEVHAFLTGDQNHDKKDEIYLLLNFFFEHLRENED 494 >ref|XP_002310520.1| predicted protein [Populus trichocarpa] gi|222853423|gb|EEE90970.1| predicted protein [Populus trichocarpa] Length = 710 Score = 60.8 bits (146), Expect = 1e-07 Identities = 23/44 (52%), Positives = 34/44 (77%) Frame = -1 Query: 532 KGLQRVPGCSWIEIQSNIHVFVTRDEKHDQSNEIYMLLWIFLKH 401 +G+ + PGCSWI+IQSN+HVF+ +D++H Q EIY +L + KH Sbjct: 628 RGVVKQPGCSWIDIQSNVHVFMVKDKRHPQKKEIYSILKLLTKH 671 >ref|XP_002274656.2| PREDICTED: pentatricopeptide repeat-containing protein At5g42450, mitochondrial-like [Vitis vinifera] Length = 538 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = -1 Query: 532 KGLQRVPGCSWIEIQSNIHVFVTRDEKHDQSNEIYMLLWIFLKHATDSQNL 380 K ++ VPG SWIEI+S +H+FVT D HDQ +EIY +L ++H ++ +L Sbjct: 475 KRMKGVPGSSWIEIRSKVHIFVTGDRNHDQHDEIYQVLGFCIQHLRETYSL 525