BLASTX nr result
ID: Angelica22_contig00031475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00031475 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600666.1| Ribosomal protein-like protein [Medicago tru... 57 1e-06 ref|XP_003595815.1| hypothetical protein MTR_2g061140 [Medicago ... 57 2e-06 ref|XP_002442327.1| hypothetical protein SORBIDRAFT_08g018260 [S... 55 6e-06 >ref|XP_003600666.1| Ribosomal protein-like protein [Medicago truncatula] gi|355489714|gb|AES70917.1| Ribosomal protein-like protein [Medicago truncatula] Length = 281 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/79 (37%), Positives = 44/79 (55%), Gaps = 4/79 (5%) Frame = +3 Query: 18 MDETPSLESLTEEFIHEFCYDDTEDDRILELYHERHGQSSRSMPRRS----IFRDREAGH 185 MD +++ E I + C +D ++ ++ L HE Q++ + +R I R RE GH Sbjct: 1 MDPNIEWDNIWNEVIDD-CLNDNNEEEVIMLVHEAQQQANNTSKQRKRRTLIDRSREEGH 59 Query: 186 QRLVNDYFSPNPVYTEQMF 242 +L NDYFS NPVYTE F Sbjct: 60 NQLFNDYFSENPVYTEAQF 78 >ref|XP_003595815.1| hypothetical protein MTR_2g061140 [Medicago truncatula] gi|355484863|gb|AES66066.1| hypothetical protein MTR_2g061140 [Medicago truncatula] Length = 428 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Frame = +3 Query: 30 PSLESLTEEFIHEFCYDDTEDDRILELYHERHGQSSRSMP-RRSIFRDREAGHQRLVNDY 206 PS S + ++ DD D+ +L L E SSR RR+I R+RE GH+RL NDY Sbjct: 3 PSNPSHIAKLFMDYMNDDL-DEELLRLAQEEFASSSRPRSQRRNIERNREEGHERLFNDY 61 Query: 207 FSPNPVYTEQMF 242 FS PVYT++ F Sbjct: 62 FSETPVYTDEQF 73 >ref|XP_002442327.1| hypothetical protein SORBIDRAFT_08g018260 [Sorghum bicolor] gi|241943020|gb|EES16165.1| hypothetical protein SORBIDRAFT_08g018260 [Sorghum bicolor] Length = 576 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 2/82 (2%) Frame = +3 Query: 3 NPQFHMDETPSLESLTEEFIHEFCYDDTEDDRILELYHERHGQSSRS--MPRRSIFRDRE 176 +P + P +E++ E FI++ + ++ + G+SS+ + RR I RDRE Sbjct: 17 SPSHALPHIPPIEAIWE-FINDPIEEKIVAQIAAQIEKQERGESSQHQRLSRRYIVRDRE 75 Query: 177 AGHQRLVNDYFSPNPVYTEQMF 242 AG RL+ DYFS NPVYT++ F Sbjct: 76 AGQNRLIRDYFSTNPVYTDEQF 97