BLASTX nr result
ID: Angelica22_contig00031387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00031387 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003519187.1| PREDICTED: purine permease 3-like [Glycine max] 61 8e-08 ref|XP_003602860.1| Purine permease [Medicago truncatula] gi|355... 61 1e-07 ref|XP_002285719.1| PREDICTED: purine permease 3-like [Vitis vin... 56 3e-06 ref|XP_003602862.1| Purine permease [Medicago truncatula] gi|355... 56 4e-06 ref|XP_002285718.1| PREDICTED: purine permease 3 [Vitis vinifera] 55 5e-06 >ref|XP_003519187.1| PREDICTED: purine permease 3-like [Glycine max] Length = 344 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 319 EKGVALVLSLWGFVSYFYGEIKHSKNAEKNRAAETEL 209 EKGVALVLSLWGFVSYFYGEIK + KNR ET+L Sbjct: 300 EKGVALVLSLWGFVSYFYGEIKQDREKNKNRCPETDL 336 >ref|XP_003602860.1| Purine permease [Medicago truncatula] gi|355491908|gb|AES73111.1| Purine permease [Medicago truncatula] Length = 440 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -1 Query: 319 EKGVALVLSLWGFVSYFYGEIKHSKNAEKNRAAETELQLNQVAVEENV 176 EKGV+LVLSLWGFVSYFYGEIKH+K +K R+ E E+ + +N+ Sbjct: 325 EKGVSLVLSLWGFVSYFYGEIKHAKAEKKKRSLEIEMGQTIEGLPKNI 372 >ref|XP_002285719.1| PREDICTED: purine permease 3-like [Vitis vinifera] Length = 351 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 319 EKGVALVLSLWGFVSYFYGEIKHSKNAEKNRAAETEL 209 EKGV+L LSLWGFVSYFYGEIK SK +KN +ETEL Sbjct: 310 EKGVSLALSLWGFVSYFYGEIKDSKK-KKNPTSETEL 345 >ref|XP_003602862.1| Purine permease [Medicago truncatula] gi|355491910|gb|AES73113.1| Purine permease [Medicago truncatula] Length = 131 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = -1 Query: 319 EKGVALVLSLWGFVSYFYGEIKHSKNAEKNRAAETEL 209 EKGV+LVLSLWGFVSYFYGEIKH+K +K + E ++ Sbjct: 85 EKGVSLVLSLWGFVSYFYGEIKHAKAEKKKCSLEIKM 121 >ref|XP_002285718.1| PREDICTED: purine permease 3 [Vitis vinifera] Length = 351 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 319 EKGVALVLSLWGFVSYFYGEIKHSKNAEKNRAAETEL 209 EKGV+L LSLWGFVSYFYGEIK SK +KN ETEL Sbjct: 310 EKGVSLALSLWGFVSYFYGEIKDSKK-KKNPTPETEL 345