BLASTX nr result
ID: Angelica22_contig00031349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00031349 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529854.1| hypothetical protein RCOM_0260450 [Ricinus c... 114 1e-23 ref|XP_002300772.1| NAC domain protein, IPR003441 [Populus trich... 112 2e-23 ref|XP_002307652.1| NAC domain protein, IPR003441 [Populus trich... 112 3e-23 ref|XP_003554290.1| PREDICTED: protein CUP-SHAPED COTYLEDON 3-li... 112 4e-23 ref|XP_003520604.1| PREDICTED: protein CUP-SHAPED COTYLEDON 3-li... 112 4e-23 >ref|XP_002529854.1| hypothetical protein RCOM_0260450 [Ricinus communis] gi|223530682|gb|EEF32555.1| hypothetical protein RCOM_0260450 [Ricinus communis] Length = 58 Score = 114 bits (284), Expect = 1e-23 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +2 Query: 95 MGLRDIGAELPPGFRFYPSDEELVCHYLYKKISNEEVLKGTLVEIDLHTCEPW 253 MGLRDIGA LPPGFRFYPSDEELVCHYLYKKI+NEEVLKGTLVEIDLHTCEPW Sbjct: 1 MGLRDIGATLPPGFRFYPSDEELVCHYLYKKITNEEVLKGTLVEIDLHTCEPW 53 >ref|XP_002300772.1| NAC domain protein, IPR003441 [Populus trichocarpa] gi|222842498|gb|EEE80045.1| NAC domain protein, IPR003441 [Populus trichocarpa] Length = 280 Score = 112 bits (281), Expect = 2e-23 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +2 Query: 95 MGLRDIGAELPPGFRFYPSDEELVCHYLYKKISNEEVLKGTLVEIDLHTCEPW 253 MGLRDIGA LPPGFRFYP+DEELVCHYLYKKI+NEEVLKGTLVEIDLHTCEPW Sbjct: 1 MGLRDIGATLPPGFRFYPNDEELVCHYLYKKITNEEVLKGTLVEIDLHTCEPW 53 >ref|XP_002307652.1| NAC domain protein, IPR003441 [Populus trichocarpa] gi|222857101|gb|EEE94648.1| NAC domain protein, IPR003441 [Populus trichocarpa] Length = 285 Score = 112 bits (280), Expect = 3e-23 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = +2 Query: 95 MGLRDIGAELPPGFRFYPSDEELVCHYLYKKISNEEVLKGTLVEIDLHTCEPW 253 MGLRDIGA LPPGFRFYPSDEELVCHYLYKKI+NE+VLKGTLVE+DLHTCEPW Sbjct: 1 MGLRDIGATLPPGFRFYPSDEELVCHYLYKKITNEQVLKGTLVEVDLHTCEPW 53 >ref|XP_003554290.1| PREDICTED: protein CUP-SHAPED COTYLEDON 3-like [Glycine max] Length = 146 Score = 112 bits (279), Expect = 4e-23 Identities = 50/53 (94%), Positives = 51/53 (96%) Frame = +2 Query: 95 MGLRDIGAELPPGFRFYPSDEELVCHYLYKKISNEEVLKGTLVEIDLHTCEPW 253 MGLRDIGA LPPGFRFYPSDEELVCHYLYKKI+NEEVLKGTLVEIDLH CEPW Sbjct: 1 MGLRDIGASLPPGFRFYPSDEELVCHYLYKKIANEEVLKGTLVEIDLHICEPW 53 >ref|XP_003520604.1| PREDICTED: protein CUP-SHAPED COTYLEDON 3-like [Glycine max] Length = 343 Score = 112 bits (279), Expect = 4e-23 Identities = 50/53 (94%), Positives = 51/53 (96%) Frame = +2 Query: 95 MGLRDIGAELPPGFRFYPSDEELVCHYLYKKISNEEVLKGTLVEIDLHTCEPW 253 MGLRDIGA LPPGFRFYPSDEELVCHYLYKKI+NEEVLKGTLVEIDLH CEPW Sbjct: 1 MGLRDIGASLPPGFRFYPSDEELVCHYLYKKIANEEVLKGTLVEIDLHICEPW 53