BLASTX nr result
ID: Angelica22_contig00031327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00031327 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529892.1| Reticuline oxidase precursor, putative [Rici... 56 3e-06 dbj|BAB68539.1| (S)-reticuline oxidase-like protein [Daucus carota] 55 6e-06 >ref|XP_002529892.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223530619|gb|EEF32495.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 419 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/68 (33%), Positives = 43/68 (63%) Frame = -1 Query: 236 VRISTVISNASTRADGLVVQLAFTGAYLGPADDLISVFDSRLPQLGMQRSDLQEVTWIEA 57 +RI++ ++N++ R D + +F G +LG D L+S+ + P+LG+Q D EV+W+E+ Sbjct: 280 IRINSQVTNSTVRQDEKTITASFVGLFLGRRDKLLSLMNLSFPELGLQEKDCNEVSWVES 339 Query: 56 LMQSSFFP 33 + + FP Sbjct: 340 TLFWAQFP 347 >dbj|BAB68539.1| (S)-reticuline oxidase-like protein [Daucus carota] Length = 506 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/71 (36%), Positives = 38/71 (53%) Frame = -1 Query: 242 IRVRISTVISNASTRADGLVVQLAFTGAYLGPADDLISVFDSRLPQLGMQRSDLQEVTWI 63 +RV + T+ SN+S R D V+ F YLG D L+ + P+LG+ R D E +WI Sbjct: 264 VRVVVDTITSNSSPRQDKKTVRFVFQCLYLGKIDTLLPIMQKYFPELGLVRDDCTETSWI 323 Query: 62 EALMQSSFFPL 30 + S FP+ Sbjct: 324 KTAPMFSGFPV 334