BLASTX nr result
ID: Angelica22_contig00031159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00031159 (554 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273812.1| PREDICTED: anthranilate phosphoribosyltransf... 86 4e-15 ref|XP_002282228.1| PREDICTED: anthranilate phosphoribosyltransf... 78 1e-12 ref|XP_003601245.1| Anthranilate phosphoribosyltransferase [Medi... 78 1e-12 ref|XP_002511378.1| anthranilate phosphoribosyltransferase, puta... 75 5e-12 gb|AAB02913.1| phosphoribosylanthranilate transferase [Arabidops... 74 2e-11 >ref|XP_002273812.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic [Vitis vinifera] gi|296087637|emb|CBI34893.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 85.9 bits (211), Expect = 4e-15 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = -2 Query: 553 GPVADSFVLNAAAALLVSGNVRTLAEGVAVARDTHVSGKALRVLESWITISNKLKES 383 GP+AD+FVLNAAAALLVSG+V TL +GVAVAR TH+SGKALR L+ W IS+K+KES Sbjct: 343 GPIADAFVLNAAAALLVSGHVSTLGDGVAVARTTHLSGKALRTLQCWTEISSKVKES 399 >ref|XP_002282228.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic [Vitis vinifera] gi|297733759|emb|CBI15006.3| unnamed protein product [Vitis vinifera] Length = 394 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/60 (63%), Positives = 49/60 (81%) Frame = -2 Query: 553 GPVADSFVLNAAAALLVSGNVRTLAEGVAVARDTHVSGKALRVLESWITISNKLKESESN 374 G +AD+FVLNAAAALLVSG V TLA+GV++AR+T SGKA++ L+ WI ISNK K + S+ Sbjct: 334 GSIADAFVLNAAAALLVSGRVNTLADGVSLARETQESGKAIKTLDLWIEISNKAKAAPSS 393 >ref|XP_003601245.1| Anthranilate phosphoribosyltransferase [Medicago truncatula] gi|355490293|gb|AES71496.1| Anthranilate phosphoribosyltransferase [Medicago truncatula] gi|388505804|gb|AFK40968.1| unknown [Medicago truncatula] Length = 394 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/56 (67%), Positives = 47/56 (83%) Frame = -2 Query: 553 GPVADSFVLNAAAALLVSGNVRTLAEGVAVARDTHVSGKALRVLESWITISNKLKE 386 GP+AD+FVLNAAAAL+VSG VR LAEGV++AR+T SGKAL+ L W ISNK+K+ Sbjct: 335 GPIADAFVLNAAAALMVSGFVRNLAEGVSLARETQQSGKALKTLNLWKDISNKIKD 390 >ref|XP_002511378.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis] gi|223550493|gb|EEF51980.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis] Length = 425 Score = 75.5 bits (184), Expect = 5e-12 Identities = 35/55 (63%), Positives = 46/55 (83%) Frame = -2 Query: 553 GPVADSFVLNAAAALLVSGNVRTLAEGVAVARDTHVSGKALRVLESWITISNKLK 389 G +AD+ +LNAAAALLVSG TLAEGV +AR+T +SGKA++ ++SWI ISNK+K Sbjct: 366 GSIADALILNAAAALLVSGCASTLAEGVGMARETQLSGKAMKTIDSWINISNKMK 420 >gb|AAB02913.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana] gi|28394222|gb|AAO42464.1| phosphorybosyl anthranilate transferase 1 [Arabidopsis thaliana] Length = 441 Score = 73.9 bits (180), Expect = 2e-11 Identities = 36/58 (62%), Positives = 46/58 (79%) Frame = -2 Query: 553 GPVADSFVLNAAAALLVSGNVRTLAEGVAVARDTHVSGKALRVLESWITISNKLKESE 380 G +ADS +LNAAAALLVS V+TLAEGV VAR+ SGKA++ L+SWI ISN ++S+ Sbjct: 384 GAIADSLILNAAAALLVSNRVQTLAEGVTVAREVQSSGKAIKTLDSWINISNLAQKSQ 441