BLASTX nr result
ID: Angelica22_contig00031081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00031081 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29559.3| unnamed protein product [Vitis vinifera] 55 6e-06 >emb|CBI29559.3| unnamed protein product [Vitis vinifera] Length = 119 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/41 (60%), Positives = 33/41 (80%), Gaps = 3/41 (7%) Frame = +2 Query: 155 MSFDGDNKQWICGKARSVNLLKVGSI---IGDPCLHQSPIQ 268 MS++ ++KQW CGKA S+NL KV +I IG+PCLHQSPI+ Sbjct: 1 MSYEKEDKQWSCGKASSMNLQKVSAIVRDIGEPCLHQSPIK 41