BLASTX nr result
ID: Angelica22_contig00030912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica22_contig00030912 (867 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31099.3| unnamed protein product [Vitis vinifera] 65 2e-08 gb|EAY82739.1| hypothetical protein OsI_37948 [Oryza sativa Indi... 65 2e-08 >emb|CBI31099.3| unnamed protein product [Vitis vinifera] Length = 385 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = -3 Query: 100 GGRCKLFLSIVGQMTTRSSVYSTSIHHFEPYTE 2 G RCKLFLSI GQMTT SSVYSTSIHHFEPYTE Sbjct: 277 GSRCKLFLSIAGQMTTGSSVYSTSIHHFEPYTE 309 >gb|EAY82739.1| hypothetical protein OsI_37948 [Oryza sativa Indica Group] Length = 985 Score = 65.1 bits (157), Expect = 2e-08 Identities = 37/59 (62%), Positives = 42/59 (71%) Frame = +2 Query: 566 LICAHQASFALWEVKQRLRRTFRNDNSIEERFISIHGYGYLGLRSGKSSLLELRGGHSC 742 LICA QA+ A WEVK+ L+RTFRND SIE+ I IH Y GLRSGKSSLL+L C Sbjct: 771 LICARQANLAFWEVKEGLKRTFRND-SIED--IYIHRNAYSGLRSGKSSLLDLHDRVIC 826